Q9Y535 RPC8_HUMAN
Gene name: POLR3H
Protein name: DNA-directed RNA polymerase III subunit RPC8
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96M85 | n/a | 0.95448 | |
| 2 | Q53QZ3 | ARHGAP15 | 0.95024 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 signal transduction GO:0007165 |
| 3 | Q4VX76 | SYTL3 | 0.93995 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | O43825 | B3GALT2 | 0.91155 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9BPV8 | P2RY13 | 0.90397 | signal transduction GO:0007165 |
| 6 | A5PLK6 | RGSL1 | 0.89551 | |
| 7 | P19827 | ITIH1 | 0.89445 | small molecule metabolic process GO:0044281 |
| 8 | P48960 | ADGRE5 | 0.88116 | cell adhesion GO:0007155 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
| 9 | Q8WUJ0 | STYX | 0.87584 | catabolic process GO:0009056 cellular protein modification process GO:0006464 nucleocytoplasmic transport GO:0006913 ... |
| 10 | O43639 | NCK2 | 0.86921 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVS STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: LGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSW STMI: DO_DISOPRED3: .................................................................DDDDDDDDDDDD....................... DO_IUPRED2A: ............................................................DDDDDDDDDDDDDDDDDDD..DDD................ DO_SPOTD: .............................................................DDDDDDDDDDDDDDDDDD..................... CONSENSUS: .............................................................DDDDDDDDDDDDDDDDDD..................... CONSENSUS_MOBI: .........................................................DDDDDDDDDDDDDDDDDDDDDD..................... RICH_MOBI_[T]: TspTgpssadaTT
AA: WTSN STMI: DO_DISOPRED3: .... DO_IUPRED2A: .... DO_SPOTD: .... CONSENSUS: .... CONSENSUS_MOBI: ....