Q96MF6 CQ10A_HUMAN
Gene name: COQ10A
Protein name: Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- generation of precursor metabolites and energy GO:0006091
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVF9 | ETNK2 | 0.90051 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 embryo development GO:0009790 ... |
| 2 | Q495A1 | TIGIT | 0.79836 | cell adhesion GO:0007155 immune system process GO:0002376 |
| 3 | A6NMD0 | IFITM10 | 0.78869 | |
| 4 | Q9HAU8 | RNPEPL1 | 0.75385 | |
| 5 | Q14164 | IKBKE | 0.73774 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 6 | P41145 | OPRK1 | 0.67601 | cell-cell signaling GO:0007267 immune system process GO:0002376 nervous system process GO:0050877 ... |
| 7 | P13945 | ADRB3 | 0.66804 | carbohydrate metabolic process GO:0005975 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 8 | Q6ZMM2 | ADAMTSL5 | 0.65284 | |
| 9 | Q69YG0 | TMEM42 | 0.63695 | |
| 10 | Q8NH09 | OR8S1 | 0.6286 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEM STMI: TTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_IUPRED2A: ..........................D..DDDDDDDDDDDD........................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....D.DDD.............................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS_MOBI: ..................................................................................... RICH_[AC]: AAerCCrlslspgAqpA RICH_[AP]: AAerccrlslsPgAqPAPPP RICH_[P]: PgaqPaPPPgPlPPP RICH_[CP]: CCrlslsPgaqPaPPPgPlP RICH_fLPS_[P]: PgaqPaPPPgPlPPP
120 140 160 180 200 AA: YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: LHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT STMI: DO_DISOPRED3: ....................................DDDDDDDDDDD DO_IUPRED2A: ............................................... DO_SPOTD: .....................................DDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDD CONSENSUS_MOBI: ...............................................