Q69YG0 TMM42_HUMAN
Gene name: TMEM42
Protein name: Transmembrane protein 42
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75147 | OBSL1 | 0.92368 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 2 | P41273 | TNFSF9 | 0.90556 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 3 | Q14164 | IKBKE | 0.8828 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 4 | Q8N1D0 | SLC22A18AS | 0.83587 | |
| 5 | Q96L94 | SNX22 | 0.83189 | protein transport GO:0015031 transport GO:0006810 |
| 6 | Q96G79 | SLC35A4 | 0.82809 | transport GO:0006810 |
| 7 | P0C864 | DANCR | 0.82435 | |
| 8 | Q9H190 | SDCBP2 | 0.81973 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 ... |
| 9 | Q4LDE5 | SVEP1 | 0.8115 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 10 | Q9BSR8 | YIPF4 | 0.80159 | biological process involved in symbiotic interaction GO:0044403 |
20 40 60 80 100 AA: MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAI STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM M DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: DDDDDD....DDD....................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........ . .................... CONSENSUS_MOBI: .................................... . .................... RICH_[AP]: AerPgPPggAvsAtAyPdtPAefPP RICH_[P]: PPggavsatayPdtPaefPP
120 140 AA: ASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGLTLIHRKLPPTWKPLPHKQQ STMI: MMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................DDDDDDDDDD DO_IUPRED2A: .........................................................D. DO_SPOTD: ..............................................DDDDDDDDDDDDD CONSENSUS: ... .....DDDDDDDDDD CONSENSUS_MOBI: ... ...............