Q69YG0 TMM42_HUMAN

Gene name: TMEM42
Protein name: Transmembrane protein 42

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O75147 OBSL1 0.92368 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
2 P41273 TNFSF9 0.90556 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
3 Q14164 IKBKE 0.8828 biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
cellular protein modification process GO:0006464
...
4 Q8N1D0 SLC22A18AS 0.83587
5 Q96L94 SNX22 0.83189 protein transport GO:0015031
transport GO:0006810
6 Q96G79 SLC35A4 0.82809 transport GO:0006810
7 P0C864 DANCR 0.82435
8 Q9H190 SDCBP2 0.81973 anatomical structure development GO:0048856
cell population proliferation GO:0008283
signal transduction GO:0007165
...
9 Q4LDE5 SVEP1 0.8115 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
10 Q9BSR8 YIPF4 0.80159 biological process involved in symbiotic interaction GO:0044403

                                           20                  40                  60                  80                 100
AA:                      MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAI
STMI:                                                        MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM                    M
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................
DO_IUPRED2A:             DDDDDD....DDD.......................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDD........                     .                     .................... 
CONSENSUS_MOBI:          ....................................                     .                     .................... 
RICH_[AP]:                AerPgPPggAvsAtAyPdtPAefPP                                                                          
RICH_[P]:                      PPggavsatayPdtPaefPP                                                                          

                                          120                 140 
AA:                      ASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGLTLIHRKLPPTWKPLPHKQQ
STMI:                    MMMMMMMMMMMMMMMMMMMM   MMMMMMMMMMMMMMMMMMMMM               
DO_DISOPRED3:            .................................................DDDDDDDDDD
DO_IUPRED2A:             .........................................................D.
DO_SPOTD:                ..............................................DDDDDDDDDDDDD
CONSENSUS:                                   ...                     .....DDDDDDDDDD
CONSENSUS_MOBI:                              ...                     ...............