Q96MZ4 F218A_HUMAN
Gene name: FAM218A
Protein name: Protein FAM218A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P31641 | SLC6A6 | 0.80198 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q96AN5 | TMEM143 | 0.72701 | |
| 3 | Q9UQ52 | CNTN6 | 0.72701 | |
| 4 | Q53HC0 | CCDC92 | 0.72038 | |
| 5 | Q86VH5 | LRRTM3 | 0.71542 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 6 | Q9NYS7 | WSB2 | 0.68662 | |
| 7 | Q9NV88 | INTS9 | 0.68662 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q29980 | MICB | 0.68327 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ... |
| 9 | Q5HYR2 | DMRTC1; | 0.67304 | |
| 10 | A2RUS2 | DENND3 | 0.66024 | catabolic process GO:0009056 transport GO:0006810 vesicle-mediated transport GO:0016192 |
20 40 60 80 100 AA: MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFS STMI: DO_DISOPRED3: DDDDDDDDDD.......................................................................................... DO_IUPRED2A: ........................D......................DD...DDDDDD.DDDD......DDD............................ DO_SPOTD: DDDDDDDDDD.....................................................................................DDDDD CONSENSUS: DDDDDDDDDD.......................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 AA: GSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL STMI: DO_DISOPRED3: ........................................................D DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...................... DO_SPOTD: DDDDD.....DDDDDDDDDDDDDDDDD............................D. CONSENSUS: ...DD.....DDDDDDDDDDDDDDDDD.............................. CONSENSUS_MOBI: ...DDDDDDDDDDDDDDDDDDDDDDDD.............................. RICH_MOBI_[K]: KlpghsKsegppgKvrK RICH_MOBI_[P]: PavtPPklPghsksegPP