Q96NF6 CH049_HUMAN
Gene name: C8orf49
Protein name: Putative uncharacterized protein C8orf49
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O95972 | BMP15 | 0.90286 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q8IZC7 | ZNF101 | 0.90249 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | O00168 | FXYD1 | 0.89379 | cellular protein modification process GO:0006464 circulatory system process GO:0003013 transmembrane transport GO:0055085 ... |
| 4 | P41181 | AQP2 | 0.88069 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 5 | Q13393 | PLD1 | 0.87397 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 6 | Q9BRK5 | SDF4 | 0.83137 | anatomical structure development GO:0048856 cell differentiation GO:0030154 transport GO:0006810 ... |
| 7 | Q9BY78 | RNF26 | 0.76331 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 |
| 8 | Q7Z7J5 | DPPA2 | 0.76088 | |
| 9 | Q8NF50 | DOCK8 | 0.72646 | cell adhesion GO:0007155 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 10 | O95461 | LARGE1 | 0.72418 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MEKPRLYQKYKISRVWWRLPVIPATREAEDNRLNPEGRGCGEPRSRHCTPAWTTTAKLHLKTIISLQPLNMYQMEPGVGSIRTSPALQSPPALTRGPSAW STMI: DO_DISOPRED3: DDD.................DDDDD........D.................................................................. DO_IUPRED2A: ...........................DDDDDDDDDDDDDD..DDDD.........................................D..D........ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD.D........ CONSENSUS: DDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDDD........ CONSENSUS_MOBI: .................................................................................................... RICH_[R]: ReaednRlnpegRgcgepRsR RICH_[EN]: EaEdNrlNpE RICH_[ER]: REaEdnRlnpEgRgcgEpRsR RICH_[GR]: GRGcGepRsR
120 140 160 180 200 AA: DTAIRKALSFGVGLGVLVLVCLFYHFVTLAPILQFASLPCLLEAGAQMSRHPVTTQVCIMPARLSLGSGISRNLLRLSVCHFTLLLPFRSLRPCPLSSRD STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......... ...................................................................... CONSENSUS_MOBI: ......... ......................................................................
220 AA: MVLSYELWLLCDFYIAPPDSSGSGICKKAI STMI: DO_DISOPRED3: ..........................DDDD DO_IUPRED2A: .............................. DO_SPOTD: ....................DD.....DDD CONSENSUS: ...........................DDD CONSENSUS_MOBI: ..............................