Q96PU9 ODF3A_HUMAN
Gene name: ODF3
Protein name: Outer dense fiber protein 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P26718 | KLRK1 | 0.8064 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q9Y2T5 | GPR52 | 0.64923 | signal transduction GO:0007165 |
| 3 | Q86Y78 | LYPD6 | 0.58476 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 4 | Q9BX82 | ZNF471 | 0.53916 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | B1ANY3 | FAM220BP | 0.47482 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 6 | P46089 | GPR3 | 0.40274 | cell cycle GO:0007049 homeostatic process GO:0042592 reproduction GO:0000003 ... |
| 7 | Q9BV47 | DUSP26 | 0.30068 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q2M3W8 | ZNF181 | 0.26541 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q7Z4H9 | FAM220A | 0.22579 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 10 | Q8IUY3 | GRAMD2A | 0.17664 | transport GO:0006810 |
20 40 60 80 100 AA: MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLT STMI: DO_DISOPRED3: DDDDDD.DDDDD........................................................................................ DO_IUPRED2A: .......D.........DD..............DD............................DD.....DDDDDD........................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.D.............................. CONSENSUS: DDDDDDDDDDDD.....DD..............DD............................DD................................... CONSENSUS_MOBI: .................................................................................................... RICH_[MW]: MteevWMgtW
120 140 160 180 200 AA: PGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQY STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: DDDD.............DD.......DDDDD..........D.D..........DDDDDDD..DD......DDDDDDDDDDDDDD.DDD........... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: TMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE STMI: DO_DISOPRED3: ...................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... DO_SPOTD: ...................................................... CONSENSUS: ...................................................... CONSENSUS_MOBI: ......DDDDDDDDDDDDDDDDDDDD............................