Q86Y78 LYPD6_HUMAN
Gene name: LYPD6
Protein name: Ly6/PLAUR domain-containing protein 6
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ECI4 | ZNF470 | 0.58797 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q96PU9 | ODF3 | 0.58476 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 3 | Q8WWF6 | DNAJB3 | 0.51435 | |
| 4 | P78543 | BTG2 | 0.50912 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | Q8IUN9 | CLEC10A | 0.48221 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 6 | P26718 | KLRK1 | 0.47155 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q8NA42 | ZNF383 | 0.44029 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q6QN14 | USP17L6P | 0.39999 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 9 | P54756 | EPHA5 | 0.39422 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q9Y2T5 | GPR52 | 0.37965 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLE STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDD..D.DDDDDD.DD.................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDD.DD................................................................................ CONSENSUS: .............................................................................. CONSENSUS_MOBI: ..............................................................................
120 140 160 AA: ECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML STMI: DO_DISOPRED3: .............................................DDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .......................................DDDDD........................... DO_SPOTD: ...............................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................... RICH_[CL]: CmsvivsCLwLwLgLmL RICH_[CW]: CmsvivsClWlW RICH_[MW]: MsvivsclWlWlglM