Q96RJ3 TR13C_HUMAN

Gene name: TNFRSF13C
Protein name: Tumor necrosis factor receptor superfamily member 13C

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell adhesion GO:0007155
- cell population proliferation GO:0008283
- homeostatic process GO:0042592
- immune system process GO:0002376
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H0N5 PCBD2 0.58532 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
2 Q8N2K1 UBE2J2 0.57258 catabolic process GO:0009056
cellular protein modification process GO:0006464
protein targeting GO:0006605
...
3 Q9HCM7 FBRSL1 0.55304
4 B4DS77 SHISA9 0.52394 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
5 O15547 P2RX6 0.51672 response to stress GO:0006950
signal transduction GO:0007165
6 Q14956 GPNMB 0.51486 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
7 Q8TEH3 DENND1A 0.51337 protein transport GO:0015031
signal transduction GO:0007165
transport GO:0006810
...
8 O00391 QSOX1 0.5121 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
9 Q8NFZ4 NLGN2 0.51097 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
10 Q9HCU0 CD248 0.51008 anatomical structure development GO:0048856
cell death GO:0008219
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVS
STMI:                                                                                                  MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD.D........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDDDDDDDDDDD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     D
CONSENSUS_MOBI:          DDDDDDDDDDDD..............................DDDDDDDDDDDDDDDDDDDDD...............                     .
RICH_[PR]:                RRgPRslRgRdaPaPtP                                                                                  
RICH_[AG]:                                                                              GAGAGeAAlplpG                        
RICH_[AL]:                                                                               AgAgeAALpLpgLL                     s
RICH_[AP]:                                                         PkPAgAssPAPrtAlqP                                         
RICH_[A]:                                                                   AprtAlqpqesvgAgAgeAA                             
RICH_[R]:                 RRgpRslRgR                                                                                         
RICH_[GL]:                                                                              GaGaGeaaLpLpGLL                     s
RICH_fLPS_[R]:                                                                                                              s
RICH_MOBI_[R]:            RRgpRslRgR                                                                                         

                                          120                 140                 160                 180                
AA:                      WRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
STMI:                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD........................................................DDDD
DO_IUPRED2A:             ......DDDDDDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                                                  PgTTPPghsvPvPaTelgsT             
RICH_[AD]:                         AssAeApDgDkDApeplD                                                        
RICH_[AL]:               wrrrqrrLrgAssAeA                                                                    
RICH_[AR]:                  RqRRlRgAssAeApdgdkdA                                                             
RICH_[D]:                                 DgDkDapeplD                                                        
RICH_[P]:                                                          PawPPPgedPgttPPghsvPvP                    
RICH_[T]:                                                                     TTppghsvpvpaTelgsTelvTTkT      
RICH_[DI]:                                DgDkDapeplDkvII                                                    
RICH_[GL]:               wrrrqrrLrGassaeapdG                                                                 
RICH_fLPS_[P]:                                                     PawPPPgedPgttPPghsvP                      
RICH_fLPS_[R]:           wRRRqRRlRgassa                                                                      
RICH_MOBI_[AD]:                    AssAeApDgDkDApeplD                                                        
RICH_MOBI_[D]:                            DgDkDapeplD                                                        
RICH_MOBI_[P]:                                             PgisdataPawPPPgedPgttPP                           
RICH_MOBI_[T]:                                                                TTppghsvpvpaTelgsTelvTTkT      
RICH_MOBI_[DI]:                           DgDkDapeplDkvIIlspgI                                               
RICH_fLPS_MOBI_[P]:                                                PawPPPgedPgttPP                           
RICH_fLPS_MOBI_[I]:                                 dkvIIlspgI