Q9H0N5 PHS2_HUMAN
Gene name: PCBD2
Protein name: Pterin-4-alpha-carbinolamine dehydratase 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6YI46 | TMEM64 | 0.74429 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 2 | Q15165 | PON2 | 0.71922 | catabolic process GO:0009056 response to stress GO:0006950 small molecule metabolic process GO:0044281 |
| 3 | Q6VVX0 | CYP2R1 | 0.71122 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 4 | O75881 | CYP7B1 | 0.71045 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 5 | P08620 | FGF4 | 0.68269 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 6 | Q9HA77 | CARS2 | 0.67492 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 7 | P05186 | ALPL | 0.67006 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 8 | Q9BRX8 | PRXL2A | 0.66245 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 9 | Q9HBU1 | BARX1 | 0.65254 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | A6NIE6 | RRN3P2 | 0.62624 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS_MOBI: ...........................DDDD..................................................................... RICH_[AG]: GAlGAtrrllAAlrGqslG RICH_[AL]: AAvLgALgAtrrLLAALrgqsLgLAA RICH_[AR]: AtRRllAAlR RICH_[A]: AAvlgAlgAtrrllAA RICH_[L]: LgaLgatrrLLaaLrgqsLgL RICH_[GL]: LGaLGatrrLLaaLrGqsLGL
120 AA: QITLTSHDCGELTKKDVKLAKFIEKAAASV STMI: DO_DISOPRED3: .............................. DO_IUPRED2A: .............................. DO_SPOTD: ............................DD CONSENSUS: .............................. CONSENSUS_MOBI: ..............................