Q96RM1 SPR2F_HUMAN

Gene name: SPRR2F
Protein name: Small proline-rich protein 2F

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P22531 SPRR2E 0.77694 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
2 P22532 SPRR2D 0.76609 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
3 Q5TA79 LCE2A 0.71016 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 P35325 SPRR2B 0.69455 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
5 Q5TA81 LCE2C 0.65857 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T754 LCE1F 0.64721 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q5TCM9 LCE5A 0.64368 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 P35326 SPRR2A 0.64083 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
9 O14633 LCE2B 0.63067 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 Q5T7P2 LCE1A 0.62087 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154

                                           20                  40                  60        
AA:                      MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
STMI:                                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD
DO_IUPRED2A:             ........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................DDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQQQckQPcQPPPvcPaPkcP        PePcPPskcPQscPPQQcQQkcPPvtPsPPcQPkcP    
RICH_[C]:                       CkqpCqpppvCpapkCpepCpppkCpepCppskCpqsCppqqCqqkC                  
RICH_[K]:                                                                    KcppvtpsppcqpKcppKsK
RICH_[P]:                          PcqPPPvcPaPkcPePcPPPkcPePcPPskcPqscPPqqcqqkcPPvtPsPPcqPkcPP   
RICH_[Q]:                   QQQQckQpcQ                             QscppQQcQQkcppvtpsppcQ        
RICH_[CK]:                                                                   KCppvtpsppCqpKCppKsK
RICH_[CP]:                      CkqPCqPPPvCPaPkCPePCPPPkCPePCPPskCPqsCPPqqCqqkCPPvtPsPPCqPkCPP   
RICH_[CQ]:                  QQQQCkQpCQpppvCpapkC        CpepCppskCpQsCppQQCQQkCppvtpsppCQpkC     
RICH_[KP]:                                                                   KcPPvtPsPPcqPKcPPKsK
RICH_fLPS_[P]:                     PcqPPPvcPaPkcPePcPPPkcPePcPPskcPqscPPqqcqqkcPPvtPsPPcqPkcPP   
RICH_fLPS_[Q]:           msyQQQQckQpcQpppvcpa                 pskcpQscppQQcQQ                    
RICH_fLPS_[C]:                  CkqpCqpppvCpapkCpepCpppkCpepCppskCpqsCppqqCqqkCppvtpsppCqpkC     
RICH_fLPS_[CPQ]:            QQQQCkQPCQPPPvCPaPkCPePCPPPkCPePCPPskCPQsCPPQQCQQkCPPvtPsPPCQPkCPP   
RICH_MOBI_[C]:                                                                CppvtpsppCqpkC     
RICH_MOBI_[K]:                                                               KcppvtpsppcqpKcppKsK
RICH_MOBI_[P]:                                                                 PPvtPsPPcqPkcPP   
RICH_MOBI_[CK]:                                                              KCppvtpsppCqpKCppKsK
RICH_MOBI_[CP]:                                                               CPPvtPsPPCqPkCPP   
RICH_MOBI_[KP]:                                                              KcPPvtPsPPcqPKcPPKsK
RICH_fLPS_MOBI_[P]:                                                            PPvtPsPPcqPkcPP   
RICH_fLPS_MOBI_[C]:                                                          kCppvtpsppCqpkCppksk
RICH_fLPS_MOBI_[PC]:                                                         kCPPvtPsPPCqPkCPP