Q5T7P2 LCE1A_HUMAN

Gene name: LCE1A
Protein name: Late cornified envelope protein 1A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T754 LCE1F 0.94137 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q5TCM9 LCE5A 0.89183 anatomical structure development GO:0048856
cell differentiation GO:0030154
3 Q5T751 LCE1C 0.88994 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 Q5T753 LCE1E 0.82894 anatomical structure development GO:0048856
cell differentiation GO:0030154
5 Q5T752 LCE1D 0.7977 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
6 Q5T7P3 LCE1B 0.78708 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q5TA77 LCE3B 0.71988 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
8 Q5TA78 LCE4A 0.71138 anatomical structure development GO:0048856
cell differentiation GO:0030154
9 Q5TA81 LCE2C 0.71081 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 O14633 LCE2B 0.70608 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80                 100
AA:                      MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCSSGGGGCCLSHHRRHRSHRHRLQSSGCCSQPSGGSSCCGG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD..................................DDDDDDDDDDDDDDDDDDDD..DDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD...........................................................DDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQsQQQcQPPPkctPkcPPkcP                                                                           
RICH_[C]:                  CqqsqqqCqpppkCtpkCppkCptpkCppkCppkC                                                 CCsqpsggssCC  
RICH_[G]:                                                                                                     GccsqpsGGssccGG
RICH_[K]:                              KctpKcppKcptpKcppKcppK                                                                
RICH_[P]:                           PPPkctPkcPPkcPtPkcPPkcPPkcPP                                                             
RICH_[S]:                                                                                            ShrhrlqSSgccSqpSggSSccgg
RICH_[CG]:                                                                                                    GCCsqpsGGssCCGG
RICH_[CK]:                        CqpppKCtpKCppKCptpKCppKCppKC                                                               
RICH_[CP]:                 CqqsqqqCqPPPkCtPkCPPkCPtPkCPPkCPPkCPP                                                             
RICH_[CQ]:                 CQQsQQQCQpppkCtpkCppkC                                                                            
RICH_[CS]:                                                                                           ShrhrlqSSgCCSqpSggSSCCgg
RICH_[GS]:                                                                                                  SSGccSqpSGGSSccGG
RICH_[KP]:                          PPPKctPKcPPKcPtPKcPPKcPPKcPP                                                             
RICH_fLPS_[P]:                      PPPkctPkcPPkcPtPkcPPkcPPkcPP                                                             
RICH_fLPS_[Q]:           mscQQsQQQcQpppkctpkc                                                                                
RICH_fLPS_[C]:             CqqsqqqCqpppkCtpkCppkCptpkCppkCppkC                                                               
RICH_fLPS_[CPQ]:           CQQsQQQCQPPPkCtPkCPPkCPtPkCPPkCPPkCPP                                                             
RICH_fLPS_[CP]:                   CqPPPkCtPkCPPkCPtPkCPPkCPPkCPP                                                             
RICH_MOBI_[PQ]:             QQsQQQcQPPPkctPkcPP                                                                              
RICH_MOBI_[C]:             CqqsqqqCqpppkCtpkC                                                                  CCsqpsggssCCgg
RICH_MOBI_[G]:                                                                                                GccsqpsGGssccGG
RICH_MOBI_[P]:                      PPPkctPkcPP                                                                              
RICH_MOBI_[S]:                                                                                              SSgccSqpSggSS    
RICH_MOBI_[CG]:                                                                                               GCCsqpsGGssCCGG
RICH_MOBI_[CP]:            CqqsqqqCqPPPkCtPkCPP                                                                              
RICH_MOBI_[CQ]:            CQQsQQQCQpppkCtpkC                                                                                
RICH_MOBI_[CS]:                                                                                             SSgCCSqpSggSSCCgg
RICH_MOBI_[GS]:                                                                                             SSGccSqpSGGSSccGG
RICH_MOBI_[KP]:                       PKctPKcPPK                                                                             
RICH_fLPS_MOBI_[C]:                                                                                            CCsqpsggssCCgg
RICH_fLPS_MOBI_[G]:                                                                                              sqpsGGssccGG

                                   
AA:                      DSGQHSGGCC
STMI:                              
DO_DISOPRED3:            DDDDD.....
DO_IUPRED2A:             ..........
DO_SPOTD:                DDDDDDDDDD
CONSENSUS:               DDDDD.....
CONSENSUS_MOBI:          DDDDDDDDDD
RICH_[G]:                dsG       
RICH_[S]:                dS        
RICH_[CG]:               dsG       
RICH_[CS]:               dS        
RICH_[GS]:               dSG       
RICH_MOBI_[C]:           dsgqhsggCC
RICH_MOBI_[G]:           dsG       
RICH_MOBI_[CG]:          dsGqhsGGCC
RICH_MOBI_[CS]:          dS        
RICH_MOBI_[GS]:          dSG       
RICH_fLPS_MOBI_[C]:      dsgqhsggCC
RICH_fLPS_MOBI_[G]:      dsGqhsGG