Q99426 TBCB_HUMAN
Gene name: TBCB
Protein name: Tubulin-folding cofactor B
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UPT9 | USP22 | 0.76578 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q8WTS1 | ABHD5 | 0.76264 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 3 | Q9NZJ6 | COQ3 | 0.73632 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 4 | P11055 | MYH3 | 0.71279 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 5 | Q92752 | TNR | 0.70706 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 6 | Q15013 | MAD2L1BP | 0.70115 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 mitotic nuclear division GO:0140014 |
| 7 | P52565 | ARHGDIA | 0.69908 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 8 | Q8N6S4 | ANKRD13C | 0.67805 | biosynthetic process GO:0009058 cell death GO:0008219 |
| 9 | O43681 | GET3 | 0.67252 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 10 | P35240 | NF2 | 0.67093 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYED STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: VSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEP STMI: DO_DISOPRED3: ......................DD..DDDDDDDDDDDDDDDDDDDDDDDDDD................................................ DO_IUPRED2A: ..................................DDDDD.DDDDDDDDDD................DD.D.............................. DO_SPOTD: ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: ...........................DDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AE]: EEErAqqEAEAAqrlAEE RICH_[AQ]: AQQeAeAAQrlA RICH_[A]: AqqeAeAAqrlA RICH_[E]: EEEraqqEaEaaqrlaEE RICH_[EQ]: EEEraQQEaEaaQ
220 240 AA: LGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI STMI: DO_DISOPRED3: ......................................DDDDDD DO_IUPRED2A: ............................................ DO_SPOTD: ....................................DDDDDDDD CONSENSUS: ......................................DDDDDD CONSENSUS_MOBI: ............................................