Q99627 CSN8_HUMAN
Gene name: COPS8
Protein name: COP9 signalosome complex subunit 8
List of terms from Generic GO subset, which this protein is a part of:
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13077 | TRAF1 | 0.66252 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 2 | Q6NXT4 | SLC30A6 | 0.64848 | |
| 3 | Q96PX8 | SLITRK1 | 0.62154 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | Q99755 | PIP5K1A | 0.53566 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 5 | Q9H7M9 | VSIR | 0.53322 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 6 | P55285 | CDH6 | 0.50037 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 7 | Q8NB25 | FAM184A | 0.49812 | |
| 8 | P50570 | DNM2 | 0.49687 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | Q01968 | OCRL | 0.47741 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 10 | P46695 | IER3 | 0.4753 | anatomical structure development GO:0048856 cell death GO:0008219 response to stress GO:0006950 ... |
20 40 60 80 100 AA: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSE STMI: DO_DISOPRED3: DDD..D.............................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: DDDDDDDDDD.......................................................................................... RICH_MOBI_[AM]: MpvAvMAesA
120 140 160 180 200 AA: TVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARL STMI: DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDDDDDD........... DO_IUPRED2A: ..........................................................................................DDD....... DO_SPOTD: ......................................................................DDDDDDDDD.DDDDDDD............. CONSENSUS: ......................................................................DDDDDDDDDDDDDDDDD............. CONSENSUS_MOBI: ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD....... RICH_MOBI_[P]: PlsePaPvPPiP RICH_MOBI_[FI]: FnkFIplsepapvppI RICH_MOBI_[FP]: FnkFiPlsePaPvPPiP RICH_MOBI_[IP]: IPlsePaPvPPIP
AA: TDYVAFLEN STMI: DO_DISOPRED3: ......... DO_IUPRED2A: ......... DO_SPOTD: ......... CONSENSUS: ......... CONSENSUS_MOBI: .........