Q99732 LITAF_HUMAN

Gene name: LITAF
Protein name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q07075 ENPEP 0.78114 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
2 Q93052 LPP 0.72663 cell adhesion GO:0007155
3 Q7Z7A3 CTU1 0.70786 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
4 Q9NVV2 C19orf73 0.70536
5 Q9NSE2 CISH 0.7047 cellular protein modification process GO:0006464
growth GO:0040007
signal transduction GO:0007165
6 P47902 CDX1 0.70016 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q6ZQN5 FOXI2 0.69593 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q8TEM1 NUP210 0.69583 biological process involved in symbiotic interaction GO:0044403
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
9 O95466 FMNL1 0.69144 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cytoskeleton organization GO:0007010
10 Q6P1J9 CDC73 0.68861 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCN
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDD...........DD......DDDDDDDDDD...D...DDDDD.....................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDD..............................................................................
RICH_[PS]:                           PSSaPSaPPS                                                                              
RICH_[PT]:                                        TvavnsyyPTPPaPmPgPTT                                                       
RICH_[PY]:                  PgPYqaatgPssaPsaPPsY        YYPtPPaPmPgPttglvtgP      PPsYYtqPaPiPnnnP                           
RICH_[AP]:                  PgPyqAAtgPssAPsAPPsyeetvA                                                                        
RICH_[AY]:                     YqAAtgpssApsAppsY                                                                             
RICH_[G]:                                                         GpttGlvtGpdGkG                                             
RICH_[N]:                                                                        NppsyytqpapipNNN                            
RICH_[P]:                   PgPyqaatgPssaPsaPP            PtPPaPmPgPttglvtgP      PPsyytqPaPiPnnnP                           
RICH_[T]:                                         TvavnsyypTppapmpgpTT                                                       
RICH_[Y]:                                      YeetvavnsYY                                                                   
RICH_[TY]:                                        TvavnsYYpTppapmpgpTT                                                       
RICH_[GP]:                                                PtPPaPmPGPttGlvtGPdGkGmnPP                                         
RICH_[GT]:                                                 TppapmpGpTTGlvTGpdG                                               
RICH_[GY]:                                                            GlvtGpdGkGmnppsYY                                      
RICH_[NP]:                                                                       NPPsyytqPaPiPNNNP                           
RICH_[NY]:                                                                       NppsYYtqpapipNNN                            
RICH_fLPS_[P]:                                            PtPPaPmPgP                                                         
RICH_fLPS_[Y]:                             appsYeetvavnsYY                                                                   
RICH_MOBI_[PS]:                      PSSaPSaPPS                                                                              
RICH_MOBI_[AP]:             PgPyqAAtgPssAPsAPP                                                                               
RICH_MOBI_[P]:              PgPyqaatgPssaPsaPP                                                                               

                                          120                 140                 160                   
AA:                      KMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
STMI:                                                                                 
DO_DISOPRED3:            .............................................................
DO_IUPRED2A:             .............................................................
DO_SPOTD:                .............................................................
CONSENSUS:               .............................................................
CONSENSUS_MOBI:          .............................................................