Q9BPX5 ARP5L_HUMAN
Gene name: ARPC5L
Protein name: Actin-related protein 2/3 complex subunit 5-like protein
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P0T7 | TMEM9 | 0.86652 | |
| 2 | Q9NYC9 | DNAH9 | 0.80759 | |
| 3 | Q9GIP4 | SLC7A5P2 | 0.75937 | |
| 4 | Q9NX24 | NHP2 | 0.73994 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 5 | Q9NY72 | SCN3B | 0.73994 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
| 6 | P47775 | GPR12 | 0.72633 | homeostatic process GO:0042592 signal transduction GO:0007165 |
| 7 | P43080 | GUCA1A | 0.71067 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nervous system process GO:0050877 ... |
| 8 | Q02790 | FKBP4 | 0.70197 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 9 | Q9NWT6 | HIF1AN | 0.6857 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q9UL63 | MKLN1 | 0.67267 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell morphogenesis GO:0000902 ... |
20 40 60 80 100 AA: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSL STMI: DO_DISOPRED3: DDD......................DDDDDDDDDDD................................................................ DO_IUPRED2A: .........................DDDDDDDDDDDDDDDDDDDDD.....................DDDDDD........................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDD......................DDDDDDDDDDDDDD............................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AE]: EqEEAAAAAAE RICH_fLPS_[A]: eqeeAAAAAA
120 140 AA: DRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV STMI: DO_DISOPRED3: ..................................................... DO_IUPRED2A: ..................................................... DO_SPOTD: ..................................................... CONSENSUS: ..................................................... CONSENSUS_MOBI: .....................................................