Q9BRX8 PXL2A_HUMAN
Gene name: PRXL2A
Protein name: Peroxiredoxin-like 2A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- immune system process GO:0002376
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96SL1 | SLC49A4 | 0.66669 | |
| 2 | Q9H0N5 | PCBD2 | 0.66245 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 3 | Q7L5D6 | GET4 | 0.63841 | catabolic process GO:0009056 membrane organization GO:0061024 response to stress GO:0006950 |
| 4 | Q6VVX0 | CYP2R1 | 0.60013 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 5 | Q9H841 | NIPAL2 | 0.57453 | transport GO:0006810 |
| 6 | O75881 | CYP7B1 | 0.57101 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 7 | Q96CN7 | ISOC1 | 0.56591 | |
| 8 | P86791 | CCZ1 | 0.56544 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | A6NFF2 | NAP1L6P | 0.56345 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 10 | P46095 | GPR6 | 0.56083 | homeostatic process GO:0042592 signal transduction GO:0007165 |
20 40 60 80 100 AA: MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GmwsiGAGAlGAAAlAlllA RICH_[AL]: AgALgAAALALLLA RICH_[AM]: MgMwsigAgAlgAAA RICH_[A]: AgAlgAAAlAlllA RICH_[L]: LgaaaLaLLL RICH_[M]: MsflqdpsfftMgM RICH_[FM]: MsFlqdpsFFtMgM RICH_[GL]: GmwsiGaGaLGaaaLaLLL RICH_fLPS_[A]: gAgAlgAAAlAlllA RICH_fLPS_[F]: msFlqdpsFF RICH_fLPS_[AL]: AgALgAAALALLLA RICH_fLPS_[L]: LgaaaLaLLL
120 140 160 180 200 AA: MLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHRE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: KEFGDKVNLLSVLEAAKMIKPQTLASEKK STMI: DO_DISOPRED3: .....................D.DDDDDD DO_IUPRED2A: ............................. DO_SPOTD: ...................DDDDDDDDDD CONSENSUS: .....................DDDDDDDD CONSENSUS_MOBI: .............................