Q9BT23 LIMD2_HUMAN

Gene name: LIMD2
Protein name: LIM domain-containing protein 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9P253 VPS18 0.93158 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell-cell signaling GO:0007267
...
2 Q9H1K6 TLNRD1 0.92898
3 Q13619 CUL4A 0.86603 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
4 Q6ICL7 SLC35E4 0.86056
5 Q5VW00 DCAF12L2 0.83726
6 A6NIH7 UNC119B 0.80444 anatomical structure development GO:0048856
cellular component assembly GO:0022607
protein transport GO:0015031
...
7 Q9UJA2 CRLS1 0.77935 biosynthetic process GO:0009058
8 Q5TAB7 RIPPLY2 0.77701 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 Q86X52 CHSY1 0.77207 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q5VVJ2 MYSM1 0.7566 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MFQAAGAAQATPSHDAKGGGSSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
DO_IUPRED2A:             ............DDDDDDDDD...............................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
RICH_[AG]:                  AAGAAqAtpshdAkGGG                                                                                
RICH_[A]:                   AAgAAqAtpshdA                                                                                    
RICH_[S]:                            ShdakgggSStvqrSkSfS                                                                     
RICH_fLPS_[A]:            fqAAgAAqAtpshdA                                                                                    
RICH_MOBI_[AG]:             AAGAAqAtpshdAkGGG                                                                                
RICH_MOBI_[A]:              AAgAAqAtpshdA                                                                                    
RICH_fLPS_MOBI_[A]:       fqAAgAAqAtpshdA                                                                                    

                                          120             
AA:                      NYDEGFGRKQHKELWAHKEVDPGTKTA
STMI:                                               
DO_DISOPRED3:            ........DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ................DD.......DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ........DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................
RICH_[HK]:                       KqHKelwaHK