Q5TAB7 RIPP2_HUMAN

Gene name: RIPPLY2
Protein name: Protein ripply2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H1K6 TLNRD1 0.84179
2 Q9P253 VPS18 0.83552 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell-cell signaling GO:0007267
...
3 Q13619 CUL4A 0.83511 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
4 Q9NR33 POLE4 0.80512 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
5 Q5VW00 DCAF12L2 0.79499
6 P29966 MARCKS 0.78795 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
7 Q9BT23 LIMD2 0.77701
8 Q6QNY1 BLOC1S2 0.77011 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
9 Q6ICL7 SLC35E4 0.76647
10 Q96S44 TP53RK 0.76106 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLYQFRHPVRLFWPKSKCYDYLYQEAEALL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDD.DD...................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDD..D...D..............DDDDDDDDDDDDDDDDDDDDD...D.D..............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDD.............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_[AE]:                                                              EEEtpnhAAEAmpdgpgmtA                                 
RICH_[AG]:                  AGGAeGtesGAAAcAAtdG                                                                              
RICH_[AM]:                                                                     AAeAMpdgpgMtAA                                
RICH_[A]:                   AggAegtesgAAAcAAtdgptrrAgA                         AAeAmpdgpgmtAA                                
RICH_[E]:                                                               EEEtpnhaaE                                           
RICH_[EG]:                EnaGGaEGtE                                                                                         
RICH_fLPS_[A]:              AggAegtesgAAAcAAtdgptrrAgA                                                                       
RICH_MOBI_[AE]:                                                    AggkkEEEtpnhAAEA                                          
RICH_MOBI_[AG]:             AGGAeGtesGAAAcAAtdG    AGAdsGyAGfwrpwvdAGG                                                       
RICH_MOBI_[AW]:                                    AgAdsgyAgfWrpWvdA                                                         
RICH_MOBI_[A]:              AggAegtesgAAAcAAtdgptrrAgAdsgyA                                                                  
RICH_MOBI_[E]:                                                          EEEtpnhaaE                                           
RICH_MOBI_[GW]:                               GptrraGadsGyaGfWrpW                                                            
RICH_fLPS_MOBI_[A]:         AggAegtesgAAAcAAtdgptrrAgAdsgyA                                                                  

                                          120            
AA:                      KNFPIQATISFYEDSDSEDEIEDLTCEN
STMI:                                                
DO_DISOPRED3:            ..............DDDDDDDDDDDDDD
DO_IUPRED2A:             ...................DDDDDDDDD
DO_SPOTD:                ..............DDDDDDDDDDDDDD
CONSENSUS:               ..............DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................
RICH_[E]:                                 EdEiEdltcE