Q9BUA6 MYL10_HUMAN
Gene name: MYL10
Protein name: Myosin regulatory light chain 10
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P49788 | RARRES1 | 0.80386 | cell population proliferation GO:0008283 |
| 2 | Q1ZZU3 | SWI5 | 0.79974 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 3 | Q9Y5R2 | MMP24 | 0.75808 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 4 | Q9GZS9 | CHST5 | 0.73402 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 5 | Q96LA6 | FCRL1 | 0.69033 | immune system process GO:0002376 signal transduction GO:0007165 |
| 6 | O95450 | ADAMTS2 | 0.68835 | anatomical structure development GO:0048856 catabolic process GO:0009056 extracellular matrix organization GO:0030198 ... |
| 7 | P04818 | TYMS | 0.68705 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | Q9BU61 | NDUFAF3 | 0.68462 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 9 | P34820 | BMP8B | 0.68317 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 10 | Q7Z5Y6 | BMP8A | 0.67703 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................D.............................. DO_IUPRED2A: ....................DD.DDDDDDDDDDDDD....................................................DDDD........ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............D.DDDDD................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[PR]: PPRPPkvlglqaPRRaRkR RICH_[AR]: ApRRARkRAegtA RICH_[P]: PqvilPPrPPkvlglqaP RICH_[R]: RppkvlglqapRRaRkR RICH_[LP]: LLrLvsnswPqviLPPrPP
120 140 160 180 200 AA: DGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFA STMI: DO_DISOPRED3: ..............................................................................................D..... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: AFPPDVCGNLDYRNLCYVITHGEEKD STMI: DO_DISOPRED3: ......................DDDD DO_IUPRED2A: .......................... DO_SPOTD: ......................DDDD CONSENSUS: ......................DDDD CONSENSUS_MOBI: ..........................