Q9BU61 NDUF3_HUMAN
Gene name: NDUFAF3
Protein name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P41250 | GARS1 | 0.75861 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 2 | Q7KZN9 | COX15 | 0.74496 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q17RB0 | RTL8B | 0.73106 | |
| 4 | Q9BUA6 | MYL10 | 0.68462 | |
| 5 | Q9HB15 | KCNK12 | 0.65582 | transmembrane transport GO:0055085 transport GO:0006810 |
| 6 | Q1ZZU3 | SWI5 | 0.64477 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 7 | Q96DB5 | RMDN1 | 0.63983 | |
| 8 | Q32NB8 | PGS1 | 0.62983 | biosynthetic process GO:0009058 |
| 9 | Q96LA6 | FCRL1 | 0.62439 | immune system process GO:0002376 signal transduction GO:0007165 |
| 10 | Q9GZS9 | CHST5 | 0.62249 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITED STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ DO_IUPRED2A: .............................D...................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[PR]: RslyRaRPslRcPPvelP RICH_[AL]: AtALALrsLyrArpsL RICH_[AR]: AtAlAlRslyRARpslR RICH_[R]: RslyRaRpslR RICH_[LP]: LrsLyrarPsLrcPPveLP RICH_[LR]: LaLRsLyRaRpsLRcppveL
120 140 160 180 AA: SFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ STMI: DO_DISOPRED3: ........................................................................DDDDDDDDDDDD DO_IUPRED2A: ...........................D.......................................D.........DDDD... DO_SPOTD: ........................................................................DDDDDDDDDDDD CONSENSUS: ........................................................................DDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................................