Q9BUE0 MED18_HUMAN
Gene name: MED18
Protein name: Mediator of RNA polymerase II transcription subunit 18
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BUL8 | PDCD10 | 0.8064 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 2 | Q9NPF2 | CHST11 | 0.70711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q9BVA6 | FICD | 0.70711 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 4 | Q8TBF8 | FAM81A | 0.69614 | |
| 5 | O75469 | NR1I2 | 0.68761 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 6 | Q9UNH6 | SNX7 | 0.68279 | protein transport GO:0015031 transport GO:0006810 |
| 7 | Q15262 | PTPRK | 0.65902 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | P28476 | GABRR2 | 0.59002 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 9 | Q8NFT2 | STEAP2 | 0.58124 | homeostatic process GO:0042592 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | Q9UIL1 | SCOC | 0.57735 | catabolic process GO:0009056 |
20 40 60 80 100 AA: MEAPPVTMMPVTGGTINMMEYLLQGSVLDHSLESLIHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDRAGAPWHLRYLGQPEMGDKNRHA STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .DDDD.D............................................................................................. DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_fLPS_[M]: MeappvtMMp
120 140 160 180 200 AA: LVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGHLFRKGIMKIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAEQLKPLVHLE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ......................................................DDDDDD........................................ CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: KIDPKRLM STMI: DO_DISOPRED3: ......DD DO_IUPRED2A: ........ DO_SPOTD: ....DDDD CONSENSUS: ......DD CONSENSUS_MOBI: ........