Q9BUL8 PDC10_HUMAN
Gene name: PDCD10
Protein name: Programmed cell death protein 10
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8NGR1 | OR13A1 | 0.8064 | nervous system process GO:0050877 signal transduction GO:0007165 |
2 | Q9BUE0 | MED18 | 0.8064 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
3 | Q01629 | IFITM2 | 0.59136 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ... |
4 | Q9P0W0 | IFNK | 0.58991 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
5 | Q9BVA6 | FICD | 0.57021 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
6 | Q9NPF2 | CHST11 | 0.57021 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
7 | Q8TBF8 | FAM81A | 0.56137 | |
8 | O75469 | NR1I2 | 0.5545 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
9 | Q9UNH6 | SNX7 | 0.5506 | protein transport GO:0015031 transport GO:0006810 |
10 | Q15262 | PTPRK | 0.53144 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.................................................................................... DO_IUPRED2A: DDDDDDDDDDDD........................................................................................ DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[EM]: MtMEEMknEaE RICH_fLPS_[M]: MrMtMeeMkneaett
120 140 160 180 200 AA: QDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQ STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: TNLILQTFKTVA STMI: DO_DISOPRED3: ............ DO_IUPRED2A: ............ DO_SPOTD: ............ CONSENSUS: ............ CONSENSUS_MOBI: ............