Q9BY19 M4A8_HUMAN
Gene name: MS4A8
Protein name: Membrane-spanning 4-domains subfamily A member 8
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P18075 | BMP7 | 0.89443 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | Q96LQ0 | PPP1R36 | 0.848 | |
| 3 | Q96RD7 | PANX1 | 0.78488 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 4 | O43897 | TLL1 | 0.75698 | anatomical structure development GO:0048856 cell differentiation GO:0030154 extracellular matrix organization GO:0030198 |
| 5 | P60228 | EIF3E | 0.75682 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 6 | Q9C0A0 | CNTNAP4 | 0.74329 | cell adhesion GO:0007155 cell-cell signaling GO:0007267 |
| 7 | O95758 | PTBP3 | 0.73058 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 8 | Q96RQ1 | ERGIC2 | 0.71067 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q3B7J2 | GFOD2 | 0.70711 | extracellular matrix organization GO:0030198 |
| 10 | Q8NFJ6 | PROKR2 | 0.70711 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLS STMI: MMMMMMMMMMMMMMMMMMMMM MM DO_DISOPRED3: DDDDDDDDDDDD.....DD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDD......................................DDDDDDDDDDDDD....................................... CONSENSUS: DDDDDDDDDD......................................DDDDDDDDDDD............... ... CONSENSUS_MOBI: .......................................................................... ... RICH_[N]: NppslvsNvN
120 140 160 180 200 AA: ISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC STMI: MMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................................................D......D....... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................. ....................... CONSENSUS_MOBI: ................. .......................
220 240 AA: ASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK STMI: M DO_DISOPRED3: ......................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................. DO_SPOTD: ..........................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................