Q9C010 IPKB_HUMAN

Gene name: PKIB
Protein name: cAMP-dependent protein kinase inhibitor beta

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H0M4 ZCWPW1 0.67487
2 Q96CT7 CCDC124 0.65525 cell cycle GO:0007049
cell division GO:0051301
3 P19087 GNAT2 0.65246 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 A8MZ26 EFCAB9 0.6339 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
5 Q49MG5 MAP9 0.62508 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
6 Q9ULG1 INO80 0.62017 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
7 Q8NB78 KDM1B 0.61724 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
8 P15918 RAG1 0.61286 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
9 Q9ULW0 TPX2 0.60873 cell cycle GO:0007049
cell death GO:0008219
cell division GO:0051301
...
10 Q13061 TRDN 0.60657 circulatory system process GO:0003013
cytoskeleton organization GO:0007010
homeostatic process GO:0042592
...

                                           20                  40                  60  
AA:                      MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
STMI:                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDD.............DDDDDDDD..D.....................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AR]:                                 AssARAgRRnA                                                 
RICH_[A]:                               AnfAssArAgrrnAlpdiqssAA                                        
RICH_[K]:                                                               KlealsvKedaKeKdeKttqdqleKpqneeK
RICH_[EK]:                                                              KlEalsvKEdaKEKdEK              
RICH_[EL]:                                                           LpLkLEaLsvkEdakEkdE               
RICH_[KL]:                                                           LpLKLeaLsvKedaKeKdeK              
RICH_MOBI_[AR]:                            AssARAgRRnA                                                 
RICH_MOBI_[A]:                          AnfAssArAgrrnAlpdiqssAA                                        
RICH_MOBI_[K]:                                                          KlealsvKedaKeKdeKttqdqleKpqneeK
RICH_MOBI_[L]:                                        LpdiqssaatdgtsdLpLkL                             
RICH_MOBI_[EK]:                                                         KlEalsvKEdaKEKdEK              
RICH_MOBI_[EL]:                                                      LpLkLEaLsvkEdakEkdE               
RICH_MOBI_[KL]:                                                      LpLKLeaLsvKedaKeKdeK