Q9H0P7 AGIT1_HUMAN
Gene name: AGPAT4-IT1
Protein name: Putative uncharacterized protein encoded by AGPAT4-IT1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P28062 | PSMB8 | 0.61088 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 2 | O95922 | TTLL1 | 0.60394 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | A8MQB3 | LINC02693 | 0.58339 | |
| 4 | Q14152 | EIF3A | 0.57365 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 5 | Q9BW62 | KATNAL1 | 0.57319 | cytoskeleton organization GO:0007010 reproduction GO:0000003 |
| 6 | Q99832 | CCT7 | 0.56268 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 7 | Q8N142 | ADSS1 | 0.55908 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 8 | Q15056 | EIF4H | 0.55581 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | O75462 | CRLF1 | 0.55009 | anatomical structure development GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 10 | Q8TCG5 | CPT1C | 0.5456 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MADTQCCPPPCEFISSAGTDLALGMGWDATLCLLPFTGFGKCAGIWNHMDEEPDNGDDRGSRRTTGQGRKWAAHGTMAAPRVHTDYHPGGGSACSSVKVR STMI: DO_DISOPRED3: DDD.....................................................DDDDDDD..................................... DO_IUPRED2A: .................................................DDDDDDDDDDDDDDDDDDDDDDD..D......................... DO_SPOTD: DDDDD............................................DDDDDDDDDDDDDDDDDDDDD..DDDDD....................... CONSENSUS: DDD..............................................DDDDDDDDDDDDDDDDDDDDD....D......................... CONSENSUS_MOBI: ..................................................DDDDDDDDDDDDDDDDDDDDDDDD.......................... RICH_[R]: RgsRRttgqgR RICH_[DG]: DeepDnGDDrGsrrttGqG RICH_[DR]: DeepDngDDRgsRRttgqgR RICH_[GR]: GddRGsRRttGqGR RICH_fLPS_[D]: DeepDngDDr RICH_MOBI_[R]: RgsRRttgqgR RICH_MOBI_[DR]: DngDDRgsRR RICH_MOBI_[GR]: GddRGsRRttGqGR
120 140 160 180 AA: SHVGHTGVFFFVDQDPLAVSLTSQSLIPPLIKPGLLKAWGFLLLCAQPSANGHSLCCLLYTDLVSSHELSPFRALCLGPSDAPSACASCNCLASTYYL STMI: DO_DISOPRED3: .................................................................................................D DO_IUPRED2A: .................................................................................................. DO_SPOTD: ...........................................................................................DDDDDDD CONSENSUS: .................................................................................................D CONSENSUS_MOBI: ..................................................................................................