Q9H293 IL25_HUMAN

Gene name: IL25
Protein name: Interleukin-25

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5HYR2 DMRTC1; 0.92576
2 Q969S8 HDAC10 0.90286 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q9UBP9 GULP1 0.89523 cell death GO:0008219
membrane organization GO:0061024
transport GO:0006810
...
4 Q8N431 RASGEF1C 0.89443 signal transduction GO:0007165
5 Q8IWV2 CNTN4 0.88492 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
6 A5PLL1 ANKRD34B 0.88153
7 O43613 HCRTR1 0.88097 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
8 P46098 HTR3A 0.87513 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
9 O60500 NPHS1 0.8729 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
10 P33076 CIITA 0.87221 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNR
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD..................................D.....DDDDDDDDDDDDDDDDD.......................
DO_IUPRED2A:             DDDDD.............................................D.DDD......DD.DDDDDDDDDDDDDDD.....................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................
CONSENSUS:                                               ..................DDDDD.....DDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:                                          .........................DDDDDDDDDDDDDDDDDDDDDDDD...................
RICH_MOBI_[P]:                                                                    PvPPleParPnrhP                             

                                          120                 140                 160   
AA:                      LPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
STMI:                                                                                                 
DO_DISOPRED3:            ............................................................................D
DO_IUPRED2A:             ..........................DDD................................................
DO_SPOTD:                ............................................................................D
CONSENSUS:               ............................................................................D
CONSENSUS_MOBI:          .............................................................................