Q9UKJ0 PILRB_HUMAN
Gene name: PILRB
Protein name: Paired immunoglobulin-like type 2 receptor beta
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14829 | PPEF1 | 0.88492 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 2 | P30411 | BDKRB2 | 0.87416 | cell death GO:0008219 cellular protein modification process GO:0006464 circulatory system process GO:0003013 ... |
| 3 | P47211 | GALR1 | 0.86193 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | P17035 | ZNF28 | 0.85138 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | O94941 | UBOX5 | 0.82035 | cellular protein modification process GO:0006464 |
| 6 | Q9H3Z4 | DNAJC5 | 0.81373 | cell death GO:0008219 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
| 7 | A9QM74 | KPNA7 | 0.80218 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 ... |
| 8 | A0A0U1RQI7 | KLF18 | 0.79184 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9H5Y7 | SLITRK6 | 0.78347 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 10 | P20138 | CD33 | 0.77074 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLN STMI: SSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: .............................D...................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDD........................................................................... CONSENSUS_MOBI: .................................................................................
120 140 160 180 200 AA: WTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALAVAVLK STMI: MMMMMMMMM DO_DISOPRED3: ..........................................................DDDDDDDDDDDDDDDDDD....DD.................. DO_IUPRED2A: .....................................................................DD............................. DO_SPOTD: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD................... CONSENSUS: ..........................................................DDDDDDDDDDDDDDDDDD....D.......... CONSENSUS_MOBI: ........................................................................................... RICH_[T]: TTTiaglrvT
220 AA: TVILGLLCLLLLWWRRRKGSRAPSSDF STMI: MMMMMMMMMMMM DO_DISOPRED3: ..................DDDDDDDDD DO_IUPRED2A: ........................DDD DO_SPOTD: ..............DDDDDDDDDDDDD CONSENSUS: ......DDDDDDDDD CONSENSUS_MOBI: ...............