Q9H693 CP095_HUMAN
Gene name: C16orf95
Protein name: Uncharacterized protein C16orf95
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q92901 | RPL3L | 0.57949 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
2 | Q96GM1 | PLPPR2 | 0.55091 | signal transduction GO:0007165 |
3 | Q9BSJ6 | PIMREG | 0.54984 | cell cycle GO:0007049 cell division GO:0051301 |
4 | P48454 | PPP3CC | 0.5467 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
5 | Q8WU68 | U2AF1L4 | 0.53853 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 nucleocytoplasmic transport GO:0006913 ... |
6 | Q9UJV8 | PURG | 0.52072 | |
7 | Q6X4W1 | NSMF | 0.51483 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
8 | Q08E93 | FAM27E3 | 0.51259 | |
9 | P0DN25 | C1GALT1C1L | 0.50787 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
10 | Q9BXU3 | TEX13A | 0.50244 |
20 40 60 80 100 AA: MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKKEVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYW STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD........................DDD................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DD........... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDD................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... RICH_[AH]: HHHHeAtgAAsgAAA RICH_[A]: AtgAAsgAAA RICH_[R]: RasRsppspRR RICH_[HR]: RasRsppspRRcHHHH RICH_fLPS_[H]: asrsppsprrcHHHH RICH_MOBI_[AH]: HHHHeAtgAAsgA RICH_MOBI_[R]: RasRsppspRR RICH_MOBI_[HR]: RasRsppspRRcHHHH RICH_fLPS_MOBI_[H]: mrasrsppsprrcHHHHeat
120 140 AA: VPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS STMI: DO_DISOPRED3: ........................................................DD DO_IUPRED2A: .......................................................... DO_SPOTD: ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ........................................................DD CONSENSUS_MOBI: ..........................................................