Q9H840 GEMI7_HUMAN
Gene name: GEMIN7
Protein name: Gem-associated protein 7
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleocytoplasmic transport GO:0006913
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86VI1 | EXOC3L1 | 0.86193 | cell-cell signaling GO:0007267 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 2 | Q9BT04 | FUZ | 0.86193 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q8NAA4 | ATG16L2 | 0.86193 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 4 | P31994 | FCGR2B | 0.80029 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 5 | Q9Y226 | SLC22A13 | 0.77468 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 6 | Q8N402 | n/a | 0.77094 | |
| 7 | O95866 | MPIG6B | 0.76274 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 8 | Q5QGZ9 | CLEC12A | 0.71136 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | O95229 | ZWINT | 0.70612 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 10 | Q4KMG9 | TMEM52B | 0.68037 |
20 40 60 80 100 AA: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVA STMI: DO_DISOPRED3: DDDD....................................DDDDDDD..................................................... DO_IUPRED2A: ........DD...........DDDDDDDDD.DD.DDDDDD....DDD.D.....D............................................. DO_SPOTD: DDDD........................DDDD...DDDDDDDDDDDDDDDD................................................. CONSENSUS: DDDD........................DDDDDDDDDDDDDDDDDDDDD................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[EI]: EvpEIqEcpI RICH_[EP]: PlrPEvPEiqEcPiaqE
120 AA: NFYVSQLQTPIGVQAEALLRCSDIISYTFKP STMI: DO_DISOPRED3: ............................... DO_IUPRED2A: ............................... DO_SPOTD: ............................... CONSENSUS: ............................... CONSENSUS_MOBI: ...............................