Q9H902 REEP1_HUMAN

Gene name: REEP1
Protein name: Receptor expression-enhancing protein 1

List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q32P44 EML3 0.81054 cytoskeleton organization GO:0007010
2 Q9Y6F9 WNT6 0.80725 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q9H6S0 YTHDC2 0.77861 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
4 Q92611 EDEM1 0.76362 catabolic process GO:0009056
cellular protein modification process GO:0006464
protein transport GO:0015031
...
5 P42768 WAS 0.75361 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell morphogenesis GO:0000902
...
6 Q58A44 PCOTH 0.74787
7 P0CG12 DERPC 0.74277
8 P52849 NDST2 0.74142 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
9 Q9UPU5 USP24 0.73517 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular protein modification process GO:0006464
10 Q8TDC3 BRSK1 0.73389 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKE
STMI:                    MMMMMMMMMMMMMMMMMMMMM             MMMMMMMMMMMMMMMMMMMMM                                             
DO_DISOPRED3:            DDDDDDDDDD.D........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:                                    .............                     .............................................
CONSENSUS_MOBI:                               .............                     .............................................

                                          120                 140                 160                 180                 200
AA:                      KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGT
STMI:                                                                                                                        
DO_DISOPRED3:            ..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                                            GdGapapsGppppGsGrasGkhG                 
RICH_[P]:                                                                                PaPsgPPPPgsgrasgkhgqP               
RICH_[S]:                                                                                          SgraSgkhgqpkmSrSaSeSaSSS  
RICH_[GP]:                                                                           GdGaPaPsGPPPPGsGrasGkhGqP               
RICH_fLPS_[P]:                                                                          aPaPsgPPPP                           
RICH_fLPS_[S]:                                                                                              qpkmSrSaSeSaSSS  
RICH_MOBI_[G]:                                                                       GdGapapsGppppGsGrasGkhG                 
RICH_MOBI_[P]:                                                                           PaPsgPPPPgsgrasgkhgqP               
RICH_MOBI_[S]:                                                                                         SgkhgqpkmSrSaSeSaSSS  
RICH_MOBI_[GP]:                                                                      GdGaPaPsGPPPPGsGrasGkhGqP               
RICH_fLPS_MOBI_[P]:                                                                     aPaPsgPPPP                           
RICH_fLPS_MOBI_[S]:                                                                                             SrSaSeSaSSS  

                                            
AA:                      A
STMI:                     
DO_DISOPRED3:            D
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          D