Q9HBJ8 CLTRN_HUMAN
Gene name: CLTRN
Protein name: Collectrin
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P11926 | ODC1 | 0.83931 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | A6NH52 | TVP23A | 0.83205 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | O43934 | MFSD11 | 0.81373 | |
| 4 | Q96D46 | NMD3 | 0.78811 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nucleocytoplasmic transport GO:0006913 ... |
| 5 | P10523 | SAG | 0.7282 | signal transduction GO:0007165 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 6 | Q6UWV2 | MPZL3 | 0.70711 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 |
| 7 | Q9BQE3 | TUBA1C | 0.70711 | cell cycle GO:0007049 cell division GO:0051301 cytoskeleton organization GO:0007010 ... |
| 8 | Q8IX95 | CTAGE3P | 0.69673 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q2NL67 | PARP6 | 0.68599 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | Q8TEX9 | IPO4 | 0.66997 | cellular component assembly GO:0022607 chromosome organization GO:0051276 nucleocytoplasmic transport GO:0006913 ... |
20 40 60 80 100 AA: MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVE STMI: SSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: ...................................................................................... CONSENSUS_MOBI: ......................................................................................
120 140 160 180 200 AA: VQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDP STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ......................................................................DDDDDDDDDDDDDDDDD............. DO_IUPRED2A: .........................................................................DDDDDDDDDDDD....D.......... DO_SPOTD: ....................................DDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......................................... ........DDDDDDDDDDDDDDDDDDDD.......... CONSENSUS_MOBI: ......................................... ...................................... RICH_[DE]: EpsEvDDaED
220 AA: LDMKGGHINDAFMTEDERLTPL STMI: DO_DISOPRED3: ....................DD DO_IUPRED2A: ......D............... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......D.............DD CONSENSUS_MOBI: ......................