Q9HCU8 DPOD4_HUMAN
Gene name: POLD4
Protein name: DNA polymerase delta subunit 4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BYV2 | TRIM54 | 0.92336 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 2 | Q9BQA5 | HINFP | 0.84586 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 3 | Q8IYN2 | TCEAL8 | 0.84053 | |
| 4 | Q8TDS7 | MRGPRD | 0.79766 | signal transduction GO:0007165 |
| 5 | Q12979 | ABR | 0.79496 | anatomical structure development GO:0048856 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
| 6 | Q9HAB3 | SLC52A2 | 0.78614 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transport GO:0006810 |
| 7 | Q5ZPR3 | CD276 | 0.78606 | cell adhesion GO:0007155 cell population proliferation GO:0008283 immune system process GO:0002376 ... |
| 8 | A1L4Q6 | n/a | 0.78346 | |
| 9 | Q9NWF4 | SLC52A1 | 0.76628 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transport GO:0006810 |
| 10 | P08922 | ROS1 | 0.76023 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCS STMI: DO_DISOPRED3: DDDD....DDDD..DDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_IUPRED2A: ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDD.......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS: DDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................... CONSENSUS_MOBI: DD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ RICH_[E]: ElapElgEEpqprdEEE RICH_[EG]: EGpaGhskGElapElGEE RICH_[EP]: PaghskgElaPElgEEPqP RICH_[GP]: GPaGhskGelaPelGeePqP RICH_MOBI_[E]: ElapElgEEpqprdEEE RICH_MOBI_[EG]: EGpaGhskGElapElGEE RICH_fLPS_MOBI_[E]: EEpqprdEEE
AA: LWHLYPL STMI: DO_DISOPRED3: ....... DO_IUPRED2A: ....... DO_SPOTD: ....DDD CONSENSUS: ....... CONSENSUS_MOBI: .......