A1L4Q6 YK033_HUMAN
Protein name: Putative uncharacterized protein FLJ41423
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5ZPR3 | CD276 | 0.9833 | cell adhesion GO:0007155 cell population proliferation GO:0008283 immune system process GO:0002376 ... |
| 2 | P08922 | ROS1 | 0.97095 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 3 | Q8TDS7 | MRGPRD | 0.90359 | signal transduction GO:0007165 |
| 4 | A6NDB9 | PALM3 | 0.83479 | signal transduction GO:0007165 |
| 5 | P38646 | HSPA9 | 0.83272 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 6 | Q9Y365 | STARD10 | 0.82187 | biosynthetic process GO:0009058 signal transduction GO:0007165 transport GO:0006810 |
| 7 | Q9HAB3 | SLC52A2 | 0.79469 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transport GO:0006810 |
| 8 | Q9HCU8 | POLD4 | 0.78346 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | E5RJM6 | ANKRD65 | 0.78063 | |
| 10 | P40337 | VHL | 0.77906 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100 AA: MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFCAGCRQGPSVWSCGEPVPRRI STMI: DO_DISOPRED3: DDDDDDDDDD.........................................DDDD............................................. DO_IUPRED2A: ...........................................................D........................................ DO_SPOTD: DDDDDDDDDDDD................................DDDDDDDDDDDDD........................................... CONSENSUS: DDDDDDDDDD.........................................DDDD............................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: WVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEERESANIY STMI: DO_DISOPRED3: ................................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................................................DDDDDDDDDDDDDDDDDD. DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................................................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...............................................DDDDDDDDDDDDDDDDDDDD RICH_[E]: EsrgEndggEErE RICH_[EG]: EsrGEndGGEErE RICH_MOBI_[E]: EsrgEndggEErE RICH_MOBI_[EG]: GEndGGEErE