Q9NP72 RAB18_HUMAN
Gene name: RAB18
Protein name: Ras-related protein Rab-18
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- immune system process GO:0002376
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P40763 | STAT3 | 0.99941 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 2 | Q86SK9 | SCD5 | 0.82498 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 3 | P63104 | YWHAZ | 0.82305 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 4 | Q9P2K6 | KLHL42 | 0.81923 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 5 | Q9NX74 | DUS2 | 0.81923 | cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q6ZNG0 | ZNF620 | 0.73274 | |
| 7 | A4D2B0 | MBLAC1 | 0.67498 | |
| 8 | Q7L945 | ZNF627 | 0.64666 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9UBE0 | SAE1 | 0.62935 | cellular protein modification process GO:0006464 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 10 | P52790 | HK3 | 0.61908 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLD STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 200 AA: NWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACG STMI: DO_DISOPRED3: ............................................................................D..DDDDDDDDDDDDDDDDDDDD. DO_IUPRED2A: ................................................................................DDD..DDD............ DO_SPOTD: ............................................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................................DDDDDDDDDDDDDDDDDDDDDDD. CONSENSUS_MOBI: ..............................................................................DDDD.................. RICH_[G]: GvklshreeGqGGG RICH_[EG]: EsEnqnkGvklshrEEGqGG
AA: GYCSVL STMI: DO_DISOPRED3: ...... DO_IUPRED2A: ...... DO_SPOTD: DD.DDD CONSENSUS: ...... CONSENSUS_MOBI: ......