P63104 1433Z_HUMAN
Gene name: YWHAZ
Protein name: 14-3-3 protein zeta/delta
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- membrane organization GO:0061024
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NP72 | RAB18 | 0.82305 | anatomical structure development GO:0048856 immune system process GO:0002376 nucleocytoplasmic transport GO:0006913 ... |
| 2 | P40763 | STAT3 | 0.81895 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | P57738 | TCTA | 0.78793 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 4 | O15552 | FFAR2 | 0.78727 | cell differentiation GO:0030154 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 5 | Q96BZ9 | TBC1D20 | 0.772 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 6 | Q8N1Y9 | n/a | 0.75857 | |
| 7 | Q06587 | RING1 | 0.75572 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | Q5T319 | FAM182B | 0.74996 | |
| 9 | Q9UHB9 | SRP68 | 0.74628 | protein targeting GO:0006605 protein transport GO:0015031 transport GO:0006810 |
| 10 | Q9H598 | SLC32A1 | 0.73574 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSL STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .............................D.......................................DDDDDDDDDDD.D.................. DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: LEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ....................................................DDD............................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: AELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN STMI: DO_DISOPRED3: .................................DDDDDDDDDDDD DO_IUPRED2A: ..............................DDDDDDDDDDDDDDD DO_SPOTD: ...............................DDDDDDDDDDDDDD CONSENSUS: ...............................DDDDDDDDDDDDDD CONSENSUS_MOBI: ...............................DDDDDDDDDDDDDD RICH_[G]: GdeaeaGeGG RICH_[EG]: GdEaEaGEGGE RICH_MOBI_[G]: GdeaeaGeGG