Q9NPJ4 PNRC2_HUMAN

Gene name: PNRC2
Protein name: Proline-rich nuclear receptor coactivator 2

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WU08 STK32A 0.62472 cellular protein modification process GO:0006464
signal transduction GO:0007165
2 Q6ZQV5 ZNF788P 0.59051 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9H9A5 CNOT10 0.5854 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
4 Q8NDV7 TNRC6A 0.57075 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q6ZXV5 TMTC3 0.56525 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
6 P46063 RECQL 0.56111 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
7 Q9Y3Y4 PYGO1 0.5561 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 P56880 CLDN20 0.55418 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
9 Q8NEF9 SRFBP1 0.54963 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 P78504 JAG1 0.54963 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDD.........DDDDDD........DDDDDD.....DDD......................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDD
RICH_[AG]:                                                            GhGynssAAAwqAmqnGG                                     
RICH_[AN]:                                                                NssAAAwqAmqNggkNkNfpNN                             
RICH_[K]:                                  KnqqqlnrqKtKeqnsqmKivhKKK                                                         
RICH_[N]:                       NipapqsrNvskNqqqlN                        NssaaawqamqNggkNkNfpNNqswN                         
RICH_[Q]:                            QsrnvsknQQQlnrQktkeQnsQ                                                                 
RICH_[W]:                                                                       WqamqnggknknfpnnqsW                          
RICH_[KQ]:                                 KnQQQlnrQKtKeQnsQmK                                                               
RICH_[NQ]:                      NipapQsrNvskNQQQlNrQ                                                                         
RICH_[NS]:                                                                                    NNqSwNSSlS                     
RICH_[NW]:                                                                      WqamqNggkNkNfpNNqsWN                         
RICH_fLPS_[Q]:                       QsrnvsknQQQlnrQktkeQnsQ                                                                 
RICH_fLPS_[QK]:                            KnQQQlnrQKtKeQnsQmKivhKKK                                                         
RICH_fLPS_[K]:                                  lnrqKtKeqnsqmKivhKKK                                                         
RICH_fLPS_[N]:                                                            NssaaawqamqNggkNkNfpNNqswN                         
RICH_MOBI_[K]:                             KnqqqlnrqKtKeqnsqmKivhKKK                                                         
RICH_MOBI_[N]:                  NipapqsrNvskNqqqlN                                   NggkNkNfpNNqswN                         
RICH_MOBI_[Q]:                       QsrnvsknQQQlnrQktkeQnsQ                                                                 
RICH_MOBI_[KQ]:                            KnQQQlnrQKtKeQnsQmK                                                               
RICH_MOBI_[NQ]:                 NipapQsrNvskNQQQlNrQ                                                                         
RICH_MOBI_[NS]:                                                                               NNqSwNSSlS                     
RICH_fLPS_MOBI_[N]:                                                                  NggkNkNfpNNqswNsslsg                    

                                          120 
AA:                      PPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV
STMI:                                                           
DO_DISOPRED3:            .......................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDD...................
DO_SPOTD:                .......................................
CONSENSUS:               .......................................
CONSENSUS_MOBI:          DDDDDDDDDD.............................
RICH_MOBI_[P]:           PPsPsvlPkP