Q6ZQV5 ZN788_HUMAN
Gene name: ZNF788P
Protein name: Putative KRAB domain-containing protein ZNF788
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P56880 | CLDN20 | 0.68158 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 2 | Q96AH0 | NABP1 | 0.66575 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q8WUH6 | TMEM263 | 0.64387 | |
| 4 | Q96MM7 | HS6ST2 | 0.61696 | biosynthetic process GO:0009058 |
| 5 | P62068 | USP46 | 0.60208 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 6 | O75409 | H2AP | 0.59218 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | Q9NPJ4 | PNRC2 | 0.59051 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 8 | Q9Y3Y4 | PYGO1 | 0.58711 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q8WU08 | STK32A | 0.57666 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | A8MYZ0 | MINDY4B | 0.56968 |
20 40 60 80 AA: MRNMIPQDNENPPQQGEANQNDSVAFEDVAVNFTPDEWALLDPSQKNLYREVMQETLRNLASIEVLWKRDSLKVKVISMEKF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................D DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDD.DDD....................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDD............................................................D CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDD......................................................... RICH_[N]: NmipqdNeNppqqgeaNqN RICH_[Q]: QdnenppQQgeanQ RICH_[MN]: MrNMipqdNeN RICH_[MQ]: MrnMipQdnenppQQ RICH_[NQ]: NmipQdNeNppQQgeaNQN RICH_fLPS_[N]: rNmipqdNeNppqqgeaNqN RICH_MOBI_[N]: NmipqdNeNppqqgeaNqN RICH_MOBI_[Q]: QdnenppQQgeanQ RICH_MOBI_[MN]: MrNMipqdNeNppqqgeaN RICH_MOBI_[MQ]: MrnMipQdnenppQQgeanQ RICH_MOBI_[NQ]: NmipQdNeNppQQgeaNQN RICH_fLPS_MOBI_[N]: rNmipqdNeNppqqgeaNqN