Q9NQ50 RM40_HUMAN
Gene name: MRPL40
Protein name: 39S ribosomal protein L40, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6UXU6 | TMEM92 | 0.59542 | |
| 2 | O15198 | SMAD9 | 0.57815 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
| 3 | Q92567 | FAM168A | 0.56759 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 4 | Q13077 | TRAF1 | 0.55955 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 5 | O75197 | LRP5 | 0.55294 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | O43307 | ARHGEF9 | 0.55073 | cell death GO:0008219 signal transduction GO:0007165 |
| 7 | Q6NXT4 | SLC30A6 | 0.54769 | |
| 8 | Q8N4L2 | PIP4P2 | 0.53113 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q96PX8 | SLITRK1 | 0.52286 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | P05549 | TFAP2A | 0.5077 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARE STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD...........................DDDDDDDDDDDDDD....................................... DO_IUPRED2A: .......................DD.........................DDDDDDDDDDDDDD.DDDDDD............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD......D..DDDD.............DDDDDDDDDDDDDDDD...................................... CONSENSUS: .DDDDDDDDDDDDDDD...................................... CONSENSUS_MOBI: ...................................................... RICH_fLPS_[K]: eplrKKKKvdpKKdq
120 140 160 180 200 AA: RPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKVYT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ....DD...........................DDDDDD..........DD.....DD........D..DD.DDDDDDDDDDDDDDDDDDD.D....... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDD........ RICH_MOBI_[PY]: PfekegPhYtPPiPnYqPPegrY RICH_MOBI_[P]: PfekegPhytPPiPnyqPP RICH_MOBI_[Y]: YtppipnYqppegrY RICH_MOBI_[FP]: FPFekegPhytPPiPnyqPP RICH_MOBI_[FY]: FpFekegphYtppipnY
AA: QVEFKR STMI: DO_DISOPRED3: ...... DO_IUPRED2A: ...... DO_SPOTD: ...... CONSENSUS: ...... CONSENSUS_MOBI: ......