Q6UXU6 TMM92_HUMAN

Gene name: TMEM92
Protein name: Transmembrane protein 92

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86XT4 TRIM50 0.69577 cellular protein modification process GO:0006464
2 O43307 ARHGEF9 0.64168 cell death GO:0008219
signal transduction GO:0007165
3 A0A1B0GUC4 MYOCOS 0.63072
4 O00445 SYT5 0.62831 cell-cell signaling GO:0007267
transport GO:0006810
vesicle-mediated transport GO:0016192
5 P19544 WT1 0.61705 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q9NP73 ALG13 0.60756 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 Q9NQ50 MRPL40 0.59542 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
8 Q7Z7M8 B3GNT8 0.59083 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
9 Q9Y2B5 VPS9D1 0.58827 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
...
10 Q7Z4S9 SH2D6 0.58448 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MSQAWVPGLAPTLLFSLLAGPQKIAAKCGLILACPKGFKCCGDSCCQENELFPGPVRIFVIIFLVILSVFCICGLAKCFCRNCREPEPDSPVDCRGPLEL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                               MMMMMMMMMMMMMMMMMMMMM                      
DO_DISOPRED3:            DDDDDDDDD.DDDD...............................................................................DDDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDD..............................................DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                         ...............................                     ...............DDDDDDD
CONSENSUS_MOBI:                                    ...............................                     ......................

                                          120                 140 
AA:                      PSIIPPERVRVSLSAPPPPYSEVILKPSLGPTPTEPPPPYSFRPEEYTGDQRGIDNPAF
STMI:                                                                               
DO_DISOPRED3:            DD........................................................D
DO_IUPRED2A:             .........................DDDD.D...DDDDDDDDDDDDDD....DDDD.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD.......................DDDDDD...DDDDDDDDDDDDDD....DDDDDDD
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[PY]:                                        PtPtePPPPYsfrPeeY            
RICH_MOBI_[P]:                                     PslgPtPtePPPPysfrP               
RICH_MOBI_[FY]:                                                 YsFrpeeYtgdqrgidnpaF
RICH_fLPS_MOBI_[P]:                                PslgPtPtePPPPysfrP