Q9NR33 DPOE4_HUMAN

Gene name: POLE4
Protein name: DNA polymerase epsilon subunit 4

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- mitotic cell cycle GO:0000278

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P29966 MARCKS 0.89457 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
2 O43930 PRKY 0.84406 cellular protein modification process GO:0006464
signal transduction GO:0007165
3 Q99536 VAT1 0.82466 anatomical structure development GO:0048856
immune system process GO:0002376
transport GO:0006810
...
4 Q01650 SLC7A5 0.82266 circulatory system process GO:0003013
immune system process GO:0002376
transmembrane transport GO:0055085
...
5 P55884 EIF3B 0.82214 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
6 Q96SL8 FIZ1 0.8159 cellular protein modification process GO:0006464
7 Q9Y235 APOBEC2 0.81115 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
mRNA processing GO:0006397
8 Q9BV29 CCDC32 0.80899
9 Q96S44 TP53RK 0.80733 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
signal transduction GO:0007165
10 Q8MH63 SLC7A5P1 0.80706

                                           20                  40                  60                  80                 100
AA:                      MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................DD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[AE]:                AAAAAAgsgtprEEEgpAgEAAAsqpqA                                                                       
RICH_[AG]:                AAAAAAGsGtpreeeGpAGeAAA                                                                            
RICH_[AP]:                          PreeegPAgeAAAsqPqAP                                                                      
RICH_[A]:                 AAAAAAgsgtpreeegpAgeAAAsqpqA                                                                       
RICH_[EG]:                      GsGtprEEEGpaGE                                                                               
RICH_[EP]:                          PrEEEgPagEaaasqPqaP                                                                      
RICH_fLPS_[A]:           mAAAAAAgsgtpreeegpAgeAAAsqpqA                                                                       
RICH_MOBI_[AE]:           AAAAAAgsgtprEEEgpAgEAAAsqpqA                                                                       
RICH_MOBI_[AG]:           AAAAAAGsGtpreeeGpAGeAAA                                                                            
RICH_MOBI_[A]:            AAAAAAgsgtpreeegpAgeAAAsqpqA                                                                       
RICH_MOBI_[EG]:                 GsGtprEEEGpaGE                                                                               
RICH_fLPS_MOBI_[A]:      mAAAAAAgsgtpreeegpAgeAAAsqpqA                                                                       

                            
AA:                      NAIEAVDEFAFLEGTLD
STMI:                                     
DO_DISOPRED3:            .................
DO_IUPRED2A:             .................
DO_SPOTD:                .................
CONSENSUS:               .................
CONSENSUS_MOBI:          .................