Q9NR33 DPOE4_HUMAN
Gene name: POLE4
Protein name: DNA polymerase epsilon subunit 4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- mitotic cell cycle GO:0000278
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P29966 | MARCKS | 0.89457 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 2 | O43930 | PRKY | 0.84406 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 3 | Q99536 | VAT1 | 0.82466 | anatomical structure development GO:0048856 immune system process GO:0002376 transport GO:0006810 ... |
| 4 | Q01650 | SLC7A5 | 0.82266 | circulatory system process GO:0003013 immune system process GO:0002376 transmembrane transport GO:0055085 ... |
| 5 | P55884 | EIF3B | 0.82214 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 6 | Q96SL8 | FIZ1 | 0.8159 | cellular protein modification process GO:0006464 |
| 7 | Q9Y235 | APOBEC2 | 0.81115 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 mRNA processing GO:0006397 |
| 8 | Q9BV29 | CCDC32 | 0.80899 | |
| 9 | Q96S44 | TP53RK | 0.80733 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | Q8MH63 | SLC7A5P1 | 0.80706 |
20 40 60 80 100 AA: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................. DO_IUPRED2A: .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................DD.. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[AE]: AAAAAAgsgtprEEEgpAgEAAAsqpqA RICH_[AG]: AAAAAAGsGtpreeeGpAGeAAA RICH_[AP]: PreeegPAgeAAAsqPqAP RICH_[A]: AAAAAAgsgtpreeegpAgeAAAsqpqA RICH_[EG]: GsGtprEEEGpaGE RICH_[EP]: PrEEEgPagEaaasqPqaP RICH_fLPS_[A]: mAAAAAAgsgtpreeegpAgeAAAsqpqA RICH_MOBI_[AE]: AAAAAAgsgtprEEEgpAgEAAAsqpqA RICH_MOBI_[AG]: AAAAAAGsGtpreeeGpAGeAAA RICH_MOBI_[A]: AAAAAAgsgtpreeegpAgeAAAsqpqA RICH_MOBI_[EG]: GsGtprEEEGpaGE RICH_fLPS_MOBI_[A]: mAAAAAAgsgtpreeegpAgeAAAsqpqA
AA: NAIEAVDEFAFLEGTLD STMI: DO_DISOPRED3: ................. DO_IUPRED2A: ................. DO_SPOTD: ................. CONSENSUS: ................. CONSENSUS_MOBI: .................