Q9BV29 CCD32_HUMAN
Gene name: CCDC32
Protein name: Coiled-coil domain-containing protein 32
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y235 | APOBEC2 | 0.97922 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 mRNA processing GO:0006397 |
| 2 | Q9BSY9 | DESI2 | 0.97498 | cellular protein modification process GO:0006464 |
| 3 | Q96S44 | TP53RK | 0.95566 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 4 | Q8MH63 | SLC7A5P1 | 0.95316 | |
| 5 | Q6QNY1 | BLOC1S2 | 0.91248 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 6 | O43930 | PRKY | 0.88793 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q99536 | VAT1 | 0.87567 | anatomical structure development GO:0048856 immune system process GO:0002376 transport GO:0006810 ... |
| 8 | Q01650 | SLC7A5 | 0.86699 | circulatory system process GO:0003013 immune system process GO:0002376 transmembrane transport GO:0055085 ... |
| 9 | Q96L14 | CEP170P1 | 0.85709 | |
| 10 | P29966 | MARCKS | 0.8546 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
20 40 60 80 100 AA: MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKLRRIKGLNQEVTSKDM STMI: DO_DISOPRED3: DDD.D..DD.........................................DDDDDDDDDDDDD..................................... DO_IUPRED2A: .DDDDDDD...........................DDDDDDDD.............DD.........................................D DO_SPOTD: DDDDDDDDDDDDDD..............DDDDDDDDDD...D..DDDDDDDDDDDDDDDDDDDDDD.................................. CONSENSUS: DDDDDDDDD..........................DDDDDDD........DDDDDDDDDDDDD..................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: LRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFKRWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ STMI: DO_DISOPRED3: .................................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................................D................D......DDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: .............................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .............................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[AE]: EsqvEkpvAEdEpAAgdkpA RICH_[A]: AedepAAgdkpAAA RICH_fLPS_[A]: vAedepAAgdkpAAA RICH_MOBI_[AE]: EsqvEkpvAEdEpAAgdkpA RICH_MOBI_[A]: AedepAAgdkpAAA RICH_fLPS_MOBI_[A]: vAedepAAgdkpAAA