Q9NRF9 DPOE3_HUMAN

Gene name: POLE3
Protein name: DNA polymerase epsilon subunit 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- mitotic cell cycle GO:0000278
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q58FF8 HSP90AB2P 0.91837 protein folding GO:0006457
response to stress GO:0006950
2 Q58FF3 HSP90B2P 0.8646 catabolic process GO:0009056
protein folding GO:0006457
response to stress GO:0006950
3 Q15061 WDR43 0.85251 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
4 P55209 NAP1L1 0.85071 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 P09429 HMGB1 0.85006 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
6 P08238 HSP90AB1 0.81781 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 P39687 ANP32A 0.81055 catabolic process GO:0009056
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
8 Q92688 ANP32B 0.80446 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q01105 SET 0.79343 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 B2RPK0 HMGB1P1 0.79124 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD............................................................................................DD
DO_IUPRED2A:             DDDD..D......................DDD.........................DD..DDDDDDDDD..........D.......D.DDDDDDDDDD
DO_SPOTD:                DDDDDD.........................................................................................DDDDD
CONSENSUS:               DDDDDD.........................................................................................DDDDD
CONSENSUS_MOBI:          ............................................................................................DDDDDDDD
RICH_[K]:                                                                                                                KgKK
RICH_[EK]:                                                                                                                 KK
RICH_fLPS_[K]:                                                                                                           KgKK
RICH_MOBI_[K]:                                                                                                           KgKK
RICH_MOBI_[EK]:                                                                                                            KK
RICH_fLPS_MOBI_[K]:                                                                                                      KgKK

                                          120                 140             
AA:                      EASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
STMI:                                                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                        DkDkktDseeqDksrDeDnDeD                 
RICH_[E]:                                EEqdksrdEdndEdEErlEEEEqnEEEE   
RICH_[K]:                easeqKKKdKdKKtdseeqdK                          
RICH_[DE]:               EasEqkkkDkDkktDsEEqDksrDEDnDEDEErlEEEEqnEEE    
RICH_[DK]:                    KKKDKDKKtDseeqDKsrDeDnD                   
RICH_[EK]:               EasEqKKKdKdKKtdsEE                             
RICH_[EN]:                                                    EqNEEEEvdN
RICH_fLPS_[D]:                   DkDkktDseeqDksrDeDnDeD                 
RICH_fLPS_[E]:                                   EdndEdEErlEEEEqnEEEE   
RICH_fLPS_[K]:           easeqKKKdKdKKtdseeqdK                          
RICH_fLPS_[ED]:                  DkDkktDsEEqDksrDEDnDEDEErlEEEEqnEEEEvD 
RICH_MOBI_[D]:                   DkDkktDseeqDksrDeDnDeD                 
RICH_MOBI_[E]:                           EEqdksrdEdndEdEErlEEEEqnEEEE   
RICH_MOBI_[K]:           easeqKKKdKdKKtdseeqdK                          
RICH_MOBI_[DE]:          EasEqkkkDkDkktDsEEqDksrDEDnDEDEErlEEEEqnEEE    
RICH_MOBI_[DK]:               KKKDKDKKtDseeqDKsrDeDnD                   
RICH_MOBI_[EK]:          EasEqKKKdKdKKtdsEE                             
RICH_MOBI_[EN]:                                               EqNEEEEvdN
RICH_fLPS_MOBI_[D]:              DkDkktDseeqDksrDeDnDeD                 
RICH_fLPS_MOBI_[E]:                              EdndEdEErlEEEEqnEEEE   
RICH_fLPS_MOBI_[K]:      easeqKKKdKdKKtdseeqdK                          
RICH_fLPS_MOBI_[ED]:             DkDkktDsEEqDksrDEDnDEDEErlEEEEqnEEEEvD