Q9NS18 GLRX2_HUMAN
Gene name: GLRX2
Protein name: Glutaredoxin-2, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96CN7 | ISOC1 | 0.87996 | |
| 2 | P86791 | CCZ1 | 0.87993 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q96H72 | SLC39A13 | 0.8657 | anatomical structure development GO:0048856 homeostatic process GO:0042592 transmembrane transport GO:0055085 ... |
| 4 | Q9Y584 | TIMM22 | 0.84971 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | Q96JI7 | SPG11 | 0.83603 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 6 | Q96QE2 | SLC2A13 | 0.82321 | cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 transmembrane transport GO:0055085 ... |
| 7 | Q9C029 | TRIM7 | 0.81409 | cellular protein modification process GO:0006464 |
| 8 | Q7L5D6 | GET4 | 0.80004 | catabolic process GO:0009056 membrane organization GO:0061024 response to stress GO:0006950 |
| 9 | P31271 | HOXA13 | 0.7812 | anatomical structure development GO:0048856 |
| 10 | Q96SL1 | SLC49A4 | 0.77298 |
20 40 60 80 100 AA: MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELD STMI: TTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: .....................DDDDDDD..................................................... RICH_[AG]: AGwldrAAGAAGAAAAAAsG RICH_[AS]: AAAAASgmeSntSSS RICH_[A]: AgwldrAAgAAgAAAAAA RICH_[S]: SgmeSntSSS RICH_fLPS_[A]: sAgwldrAAgAAgAAAAAAs
120 140 160 AA: LLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ STMI: DO_DISOPRED3: ..........................................................D.DDDD DO_IUPRED2A: ................................................................ DO_SPOTD: .......................................................DDDDDDDDD CONSENSUS: ..........................................................DDDDDD CONSENSUS_MOBI: ................................................................