Q9Y584 TIM22_HUMAN
Gene name: TIMM22
Protein name: Mitochondrial import inner membrane translocase subunit Tim22
List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96H72 | SLC39A13 | 0.99503 | anatomical structure development GO:0048856 homeostatic process GO:0042592 transmembrane transport GO:0055085 ... |
| 2 | P86791 | CCZ1 | 0.97504 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q96CN7 | ISOC1 | 0.97499 | |
| 4 | Q9C029 | TRIM7 | 0.96948 | cellular protein modification process GO:0006464 |
| 5 | Q96JI7 | SPG11 | 0.92633 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 6 | O15212 | PFDN6 | 0.91974 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
| 7 | Q9NUP9 | LIN7C | 0.91596 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 8 | Q9NVX2 | NLE1 | 0.91596 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 9 | P0DMW5 | SMIM10L2B | 0.91352 | |
| 10 | Q96FN4 | CPNE2 | 0.91255 |
20 40 60 80 100 AA: MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGF STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ..DDDDDDDDDDDDDDD.........................DDDDDDDDDDDDD.DD.......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD......................DD.D.................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD.........................DDDD......................... ...... CONSENSUS_MOBI: ......................................................................... ...... RICH_[AG]: AGGsApetAG RICH_[A]: AAAApnAggsApetAgsA RICH_fLPS_[A]: AAAApnAggsApetA
120 140 160 180 AA: DPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .............................................................................................. DO_IUPRED2A: ..D.......DD.................................................................................. DO_SPOTD: .............................................................................................. CONSENSUS: ...................... .......................... .... CONSENSUS_MOBI: ...................... .......................... ....