Q9NV39 PRR34_HUMAN

Gene name: PRR34
Protein name: Proline-rich protein 34

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HC57 WFDC1 0.85212 cell population proliferation GO:0008283
growth GO:0040007
response to stress GO:0006950
2 Q5JNZ5 RPS26P11 0.84402 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 Q8N9Z2 CCDC71L 0.83357 cell differentiation GO:0030154
4 Q6UX72 B3GNT9 0.82604 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
5 P0C7M8 CLEC2L 0.79261
6 Q9HBU6 ETNK1 0.78856 biosynthetic process GO:0009058
7 P13985 HRES1 0.78455
8 Q8WWW0 RASSF5 0.77195 cell death GO:0008219
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
9 A6NKF1 SAC3D1 0.77079 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
10 Q8NAX2 KDF1 0.77041 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...

                                           20                  40                  60                  80                 100
AA:                      MPASATAAWHCPPLCLPPLPASAPTSPPNPATRPAPGPGRRARCPQSAHPAPTRGALTFWAPGSWPRVLLVPRSPGPVLRAPRLPHPAARARRRAWHGAR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D................................................
DO_IUPRED2A:             ..D...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS:               DDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                      PtsPPnPatRPaPgPgRRaRcPqsahPaP                                                
RICH_[AP]:                                  PAsAPtsPPnPAtrPAPgP                                                              
RICH_[AR]:                                             AtRpApgpgRRARcpqsAhpA                                                 
RICH_[P]:                                   PasaPtsPPnPatrPaPgPgrrarcP                                                       
RICH_[R]:                                                RpapgpgRRaR                                                         
RICH_fLPS_[P]:                             lPasaPtsPPnPatrPaPgP                                                              
RICH_MOBI_[PR]:                                 PtsPPnPatRPaPgPgRRaRcP                                                       
RICH_MOBI_[AH]:                                                                                               HpAArArrrAwHgA 
RICH_MOBI_[AP]:                                APtsPPnPAtrPAPgPgrrA                                                          
RICH_MOBI_[AR]:                                        AtRpApgpgRRARcpqsAhpA                             ApRlphpAARARRRAwhgAR
RICH_MOBI_[A]:                                                                                           AprlphpAArArrrAwhgA 
RICH_MOBI_[P]:                                  PtsPPnPatrPaPgPgrrarcP                                                       
RICH_MOBI_[R]:                                           RpapgpgRRaR                                       RlphpaaRaRRRawhgaR
RICH_MOBI_[HR]:                                                                                            RlpHpaaRaRRRawH   
RICH_fLPS_MOBI_[R]:                                                                                               RaRRRawhgaR

                                          120  
AA:                      LPGSPARAGRTFQRGLVSNSWAHAIFLPRPPNVLELQV
STMI:                                                          
DO_DISOPRED3:            ......................................
DO_IUPRED2A:             DDDDDDDDDDDDDD.......................D
DO_SPOTD:                ......................................
CONSENSUS:               ......................................
CONSENSUS_MOBI:          DDDDDDD...............................
RICH_MOBI_[AR]:          lpgspAR                               
RICH_MOBI_[R]:           lpgspaR