Q5JNZ5 RS26L_HUMAN

Gene name: RPS26P11
Protein name: Putative 40S ribosomal protein S26-like 1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HBU6 ETNK1 0.90344 biosynthetic process GO:0009058
2 P30793 GCH1 0.88491 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9NV39 PRR34 0.84402
4 O43184 ADAM12 0.84391 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
5 Q8N9Z2 CCDC71L 0.80652 cell differentiation GO:0030154
6 P0C7M8 CLEC2L 0.80507
7 A6NKF1 SAC3D1 0.80261 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
8 Q9BQ89 FAM110A 0.79907
9 Q6UX72 B3GNT9 0.79896 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
10 Q96L33 RHOV 0.78473 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MTKKRRNNSHAKKGRGHVQPIRCTNCVRCVPTDKAIKKFVIRNIVEAAAVRDISEVSVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREACKDRTPPPR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDD................................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDD.......................................................................DDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDD...................................................................DDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.......................................................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................................................................DDDDDDDDDDDDDDD
RICH_[PR]:                                                                                                       ReackdRtPPPR
RICH_[AP]:                                                                                                         AckdrtPPPr
RICH_[AR]:                                                                                                       ReAckdRtpppR
RICH_[P]:                                                                                                                PPPr
RICH_[R]:                                                                                                        ReackdRtpppR
RICH_[KN]:                 KKrrNNshaKK                                                                                       
RICH_fLPS_[P]:                                                                                                         rtPPPr
RICH_MOBI_[PR]:                                                                                                        RtPPPR
RICH_MOBI_[AP]:                                                                                                    AckdrtPPPr
RICH_MOBI_[AR]:                                                                                                  ReAckdRtpppR
RICH_MOBI_[P]:                                                                                                           PPPr
RICH_MOBI_[R]:                                                                                                 RsReackdRtpppR
RICH_fLPS_MOBI_[P]:                                                                                                    rtPPPr

                              
AA:                      FRPAGAAPRPPPKPM
STMI:                                   
DO_DISOPRED3:            ...DDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDD
RICH_[PR]:               fRPagaaPRPPPkP 
RICH_[AP]:               frPAgAAPrPPP   
RICH_[AR]:               fRpAgAApR      
RICH_[P]:                frPagaaPrPPPkP 
RICH_[R]:                fRpagaapR      
RICH_fLPS_[P]:           frPagaaPrPPPkP 
RICH_MOBI_[PR]:          fRPagaaPRPPPkP 
RICH_MOBI_[AP]:          frPAgAAPrPPP   
RICH_MOBI_[AR]:          fRpAgAApR      
RICH_MOBI_[P]:           frPagaaPrPPPkP 
RICH_MOBI_[R]:           fRpagaapR      
RICH_fLPS_MOBI_[P]:      frPagaaPrPPPkP