Q9NWA0 MED9_HUMAN

Gene name: MED9
Protein name: Mediator of RNA polymerase II transcription subunit 9

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H9H4 VPS37B 0.84337 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
2 Q96Q80 DERL3 0.83265 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
3 Q92777 SYN2 0.82389 cell-cell signaling GO:0007267
transport GO:0006810
vesicle-mediated transport GO:0016192
4 P49137 MAPKAPK2 0.8231 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 P78381 SLC35A2 0.81026 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
6 A6NGB9 WIPF3 0.79947 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
7 Q13443 ADAM9 0.79456 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
8 P0DN24 C3orf86 0.79187
9 Q9UJ55 MAGEL2 0.79128 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 P35556 FBN2 0.79038 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVHNIIKCMDKDSPEVHQDLNALKSKFQEMRKL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............DDDDDDDDDDDDDDDDDDDDD.D.D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
RICH_[PQ]:                                           PlPPPQPPPvPaPQPQQsPaPrPQsP                                              
RICH_[AP]:                                                     PAPqPqqsPAPrPqsPArA                                           
RICH_[AQ]:                                                      ApQpQQspAprpQspArA                                           
RICH_[A]:                 AsAgvAAgrqA                                                                                        
RICH_[P]:                                PPtsdqPlPdtkPlPPPqPPPvPaPqPqqsPaPrPqsP                                              
RICH_[Q]:                                                 QpppvpapQpQQspaprpQ                                                
RICH_fLPS_[P]:                           PPtsdqPlPdtkPlPPPqPPPvPaPqPqqsPaPrPqsP                                              
RICH_MOBI_[PQ]:                                      PlPPPQPPPvPaPQPQQsPaPrPQsP                                              
RICH_MOBI_[AP]:                                                PAPqPqqsPAPrPqsPArA                                           
RICH_MOBI_[AQ]:                                                 ApQpQQspAprpQspArA                                           
RICH_MOBI_[AV]:               VAAgrqAedV                                                                                     
RICH_MOBI_[A]:            AsAgvAAgrqA                                                                                        
RICH_MOBI_[P]:                           PPtsdqPlPdtkPlPPPqPPPvPaPqPqqsPaPrPqsP                                              
RICH_MOBI_[Q]:                                            QpppvpapQpQQspaprpQ                                                
RICH_MOBI_[LP]:                         LPPtsdqPLPdtkPL                                                                      
RICH_fLPS_MOBI_[P]:                      PPtsdqPlPdtkPlPPPqPPPvPaPqPqqsPaPrPqsP                                              

                                          120                 140              
AA:                      ISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCMFEIPKE
STMI:                                                                  
DO_DISOPRED3:            .............................................D
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDD...................
DO_SPOTD:                ...........................................DDD
CONSENSUS:               .............................................D
CONSENSUS_MOBI:          ..............................................