Q69YL0 NCAS2_HUMAN
Gene name: NCBP2AS2
Protein name: Protein NCBP2AS2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NX00 | TMEM160 | 0.84636 | |
| 2 | O15553 | MEFV | 0.82877 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 3 | P17152 | TMEM11 | 0.82662 | membrane organization GO:0061024 |
| 4 | A8MTW9 | n/a | 0.82659 | |
| 5 | Q8NE28 | STKLD1 | 0.82522 | |
| 6 | Q86V71 | ZNF429 | 0.81534 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q96LB3 | IFT74 | 0.80526 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | Q86X59 | LINC02875 | 0.79519 | |
| 9 | Q5VUJ9 | EFCAB2 | 0.78735 | |
| 10 | Q8NFW8 | CMAS | 0.77863 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 AA: MVLRRLLAALLHSPQLVERLSESRPIRRAAQLTAFALLQAQLRGQDAARRLQDLAAGPVGSLCRRAERFRDAFTQELRRGLRGRSGPPPGSQRGPGANI STMI: DO_DISOPRED3: DDDDD.................................................................................DDDDDDDDDDDDD DO_IUPRED2A: ............................................................................DDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..............................................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............................................................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_[PR]: RglRgRsgPPPgsqRgP RICH_[G]: GlrGrsGpppGsqrGpG RICH_[R]: RglRgRsgpppgsqR RICH_[GP]: GlrGrsGPPPGsqrGPG RICH_[GR]: RGlRGRsGpppGsqRGpG RICH_MOBI_[G]: GlrGrsGpppGsqrGpG RICH_MOBI_[R]: RRglRgRsgpppgsqR RICH_MOBI_[GP]: GPPPGsqrGPG RICH_MOBI_[GR]: RRGlRGRsGpppGsqRGpG