Q9NX18 SDHF2_HUMAN
Gene name: SDHAF2
Protein name: Succinate dehydrogenase assembly factor 2, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q68CZ6 | HAUS3 | 0.83205 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 2 | P37173 | TGFBR2 | 0.70711 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q9NUN5 | LMBRD1 | 0.65493 | biological process involved in symbiotic interaction GO:0044403 small molecule metabolic process GO:0044281 |
| 4 | Q8WWB3 | DYDC1 | 0.57907 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
| 5 | Q86WA8 | LONP2 | 0.56614 | catabolic process GO:0009056 protein maturation GO:0051604 protein targeting GO:0006605 ... |
| 6 | P52429 | DGKE | 0.56047 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 response to stress GO:0006950 ... |
| 7 | P02708 | CHRNA1 | 0.52504 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
| 8 | Q8IY95 | TMEM192 | 0.51777 | |
| 9 | Q92973 | TNPO1 | 0.50917 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 10 | O60928 | KCNJ13 | 0.47508 | transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEK STMI: TTTTTTTTTTTTTTTTTTTTTTTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......D................................................. DO_IUPRED2A: .............................................DDDDDDD......D......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD......D......................................... CONSENSUS_MOBI: ....................................................................... RICH_[DI]: DsptDsqkDmIeI
120 140 160 AA: QLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR STMI: DO_DISOPRED3: ...............................................................DDD DO_IUPRED2A: .................................................................. DO_SPOTD: ...............................................DDDDDDDDDDDDDDDDDDD CONSENSUS: ...............................................................DDD CONSENSUS_MOBI: ..................................................................