Q9NZF1 PLAC8_HUMAN
Gene name: PLAC8
Protein name: Placenta-specific gene 8 protein
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IVP9 | ZNF547 | 0.72909 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q96DA2 | RAB39B | 0.56019 | catabolic process GO:0009056 cell junction organization GO:0034330 protein transport GO:0015031 ... |
| 3 | P09565 | GIG44 | 0.52284 | |
| 4 | Q13118 | KLF10 | 0.50754 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | O95841 | ANGPTL1 | 0.50351 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 signal transduction GO:0007165 |
| 6 | Q9BWM5 | ZNF416 | 0.45366 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q9NR22 | PRMT8 | 0.43873 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 chromosome organization GO:0051276 ... |
| 8 | Q9H0E2 | TOLLIP | 0.43265 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 9 | Q9BYZ2 | LDHAL6B | 0.42333 | carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 10 | O43361 | ZNF749 | 0.40953 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLC STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: ...................D................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[PV]: PVVVVtqPgVgPgP RICH_[QV]: QaQapVVVVtQpgV RICH_[GV]: VVtqpGVGpG RICH_fLPS_[V]: mqaqapVVVVtqpgV
AA: QIKRDINRRRAMRTF STMI: DO_DISOPRED3: .............DD DO_IUPRED2A: ............... DO_SPOTD: ...........DDDD CONSENSUS: .............DD CONSENSUS_MOBI: ...............